KEGG   Pseudomonas protegens Pf-5: PFL_4189Help
Entry
PFL_4189          CDS       T00249                                 

Gene name
pvdL
Definition
(GenBank) non-ribosomal peptide synthetase PvdL
Organism
pfl  Pseudomonas protegens Pf-5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2 Thump_like
Motif
Other DBs
NCBI-ProteinID: AAY93445
UniProt: Q4K902
LinkDB All DBs
Position
complement(4862826..4875854)
Genome map
AA seq 4342 aa AA seqDB search
MTDAFELPSTLAQALQRRAVLAPDQVALRFLAEEQDQSVVLSYLDLDLRARTIAAALQAN
AEFGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLISIMADAEPRLL
LTSAGLRDSLLQMDELKAPGAPQLLCVDTLQAGLAEDWQAVALQGDDIAFLQYTSGSTAL
PKGVQVSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVL
MSPAYFLARPVRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSGWRVAYSGSE
PIRLDTLERFAEKFSACGFSHENFLASYGLAEATLFVAGGVRGQGIPALHLDDQALAQNR
AEPGQGSAMMSCGFSQPEHAVLVMDPQQLGELPDNRIGEVWAAGPSIAHGYWRNPEATAK
TFVQHAGRTWLRTGDLGFIRDGELFITGRLKDLLIVRGHNLYPQDIEKTIEREVEVVRKG
RVAAFAVTEQGQEGIGIAAEISRSVQKILPPEALIKAIRQAVAEACQEAPSVVVLLNPGA
LPKTSSGKLQRSACRTRLADGSLDYYALFPQAGSEPARVGEGSGDELQNLIGRIWQEQLQ
CASVAADDHFFLLGGNSIAATQVIARLREELGLELGLRLLFEAPTLGAFSAAVARQQQDG
GVAQGSINALSRQQPLPQSLAQNRLWITWQLDPQSSAYNIPGGLRLRGELDEEALRASFQ
QLIQRHEALRTRFFERDGQALQQVDAAGEFNLQVIDISDLPPAEREARARQIREDEARTQ
FDLEKGPLYWATLVRLDDEEHQLLLTLHHIIADGWSLNVLIDEFSRLYAAAAQGQSLELA
PLALQYADYGSWQRQWLAQGEGQRQLDYWKQQLADEAPVLNLATDHPRSAQVRHSAARHD
LRLSASLSEAVRQTAQARQATPFMLLLAAFQTLLHRYSGQGDIRIGVPNANRPRLETQGL
LGFFINTQVLRGQLDSRQSFADLLQQTRRTALEAQAHQDLPFEQLLEAFPEAREQGLFQV
MFNHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLAFDYADELFDAA
SIERLAGHFISLLEHACLQPDCALGDLPLLGNAEAAQLQQWSVAPCAPAEQWLPERLHEQ
LRQSPERTALVWDGGQLGFAELHAQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLA
IIKAGGAYVPLDPDYPAERLAYMLGDSGVQLLLTQTHLLGRMPEAPGVSAIAMDSLKLDS
WPSHAPGLHLHGEHLAYVIYTSGSTGQPKGVGNTHRALMERLQWMQDSYQLQADDVLMQK
APISFDVSVWECFWPLITGCRLLIAAPGEHRDPHRIAQLVQEYGVTTLHFVPPLLQLFVD
EPLSAECHSLRRVFSGGEALPAELRNRLLQQLPNAQLHNRYGPTETAINVTHWQCSVDDG
ERSPIGRPLGNVLCRVLDAELNLMPAGVPGELCISGQGLARGYLGRPALTAERFVVDPLS
EEGARLYRTGDRVRWCADGVLEYLGRLDQQVKLRGFRVEPQEIEARLLAQDGVAQAAVLV
RDTVAGPQLIGYYTAQASDEDETEQSARLKTALAAELPEYMVPAQLLRLDAMPLSPSGKL
DRRALPEPQWLVREHVEPSTELEQQIAAIWREVLGQPRIGLKDDFFALGGHSLLATQIIS
RTRQACDVELPLRALFEASELGAFAEQVLLIQQSGARNQQPPIARVDRSQPVPLSYSQQR
MWFLWQMEPDSPAYNVGGMARLSGVLDVGRFEAALQALILRHETLRTTFPSVNGVAHQQV
HADTGLRMAWKDFSALAPDARQQRLQQLADSEAHQPFDLETGPLLRACLVKAGEQEHYFV
LTLHHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQRQWLESGERQR
QLDYWTGQLGREHPLLELPSDRPRPAVQSHQGELYRFDLSDELAARVRAFNAEHGLTLFM
TMTAALSLLLYRYSGQSDLRIGAPVANRIRPESEGLIGAFLNTQVLRCQLDGQMSVSQLL
EQVRHTVIEGQSHQDLPFDHLVEALQPPRSTAYNPLFQVMCNVQRWEFQQSRQLAGMTVE
YLVNDARATKFDLNLEVTDLDQRLGCCLTYSTDLFDEPRIARMAAHWRNLLEALLSDPQQ
RLCELPLLHAEEQQQLLDSLSVEPGEQRLDQCIHHLFSEQALARKDAPALTFAGQTLSYS
ELDSRANRLAWMLRERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRL
HYMIEDSGIGLLLSDARMFAALGELPISVGRWCLEEDGALLADYPAGELPFISLPQHQAY
LIYTSGSTGQPKGVVVSHGEIAMHCQAVIRRFGMRADDCELHFYSINFDAATERLLVPLL
SGAQVVLRAQGQWDAEEICQLIRQHRISILGFTPSYGSQLAQHLATQQQTLPVRMCITGG
EALTGEHLQRIRAAFQPSLFFNAYGPTETVVMPLASLAPEQLADGVASVPIGRIVGARVA
YILDADLALVPQGATGELYVGGAGLAQGYHRRPGMSAERFVADPFATDGGRLYRTGDLVR
QCADGQVEYIGRVDHQVKIRGFRIELGEIETRLLDHPAVREAVVLALDTPAGKQLAGYLV
TEVAEHNDVQQANLREALKQQLKTQLPDYMVPTHLILLASMPLTANGKLDRRALPLPDPE
LNRQQYVAPSNELEQTLAGVWGEVLNVQQVGLNDNFFELGGDSILSIQVVSRARQLGIHF
TPRDLFQHQTVQTLARVASHTQRVSAEQGQLSGEASLTPIQHWFFDSRIPQPQHWNQALL
LEPLGTLDGSLLEQALLAVLEQHDALRLRFSQAGGQAGGQWRAEYLPLSDAPLLWQVRVP
SMATCEALFADAQRSLDLEHGPLLRAVLVDGPEGEQRLLLTIHHLVVDGVSWRVLLEDLQ
NAYRQLQAGQALKLPAKTSALRDWSSRLQAYAGSESLREELGWWQQQLAGPAAQLPGLKA
TGSQQHQQAQSHSVTLDAERTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSALVQ
LEGHGREALFDEIDLTRTVGWFTSAYPLRLTPLQVEEAAGQGASIKAIKEQLRAVPHKGL
GYGVLRYLADESCREALAALPLAPVTFNYLGQFDQSFGTDALLRPLDESVGPAHAPEAPL
PNELSIDSQVYGGELVLRWTYSSERFDAELISELASAYLGELQSLIGHCLKDDAGGLTPS
DFPLARLTQAQLDGLPVPAAQIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSEL
DPERFAQAWQAVVARHEALRASFCWNVGEDMLQVIHKPGRTPIEFLDWSAVPEAEQEAKL
QALHKQEREAGFDLLNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEIYT
ALGEGREAQLAVPPRYRDYIGWLQHQSLSEARQWWRQNLEGFERTTPIPSDRPFLREHAG
DSGGMIVGDCYTRLDARDGAQLRELAQQHQLTVNTFAQAAWALVLRRMSGDRDVLFGVTV
AGRPVEMPEMQRTVGLFINSIALRVKLPQDGERCSVRQWLSGLLDSNMQLREYEYLPLVA
IQETSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPITAVCYPGDD
LGLHLSYDQRYFEQATIERMLGEFKRLLLALMQGFHGDMAELPLLGEEEQDFLLAGCNQS
EHEYPLERSYVELFEAQVAAHPQRIAASCLDQRYSYAELNRCSNRLGHALVANGVGFDQP
VALLAERGLELLGMIIGSFKAGAGYLPLDPGLPGQRLGRIIELSRTPILVCTAACREQAQ
ALLDEFGCAGRPRLLVWEELQAAGHAEHNPGRYSAPDNLAYVIYTSGSTGLPKGVMVEQR
GMLNNQLSKVPYLHLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNTIAHDPQGL
LAHVEEQGITVLESVPSLIQGMLAQDAIALDGLRWMLPTGEAMPPELAHQWLLRYPQVGL
VNAYGPAECSDDVAFFRVDMASTRGAYLPIGTPTDNNQLYLMDEALELVPLGAVGELCVA
GTGVGRGYVSDPLRTALAFVPHPFGAAGERLYRTGDLARRRSDGVLEYVGRIDHQVKIRG
YRIELGEIEARLHEQPELRDAAVGVQEGVNGKHLVGYLVASDTNLSPSECLERIKPRLRA
ELPEYMVPLHWLWLAHLPLNANGKLDRKALPALEIGQLQSQDYLAPGNELEQTLADIWAE
VLKVERVGVRDNFFELGGHSLLATQIASRVQKTLQRNVPLRAMFECSTVQELAAYIDGLG
ANEISEEKVDRLSDLMAELEGL
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcgttcgaactccccagcaccctggcccaagcccttcaacgccgggcagtc
ctggcacctgatcaagtggcgttgcgctttctcgccgaagagcaggatcagagcgtggtc
ctcagttacctggacctggaccttcgtgcgcgcaccattgctgcggctctgcaagccaac
gccgaattcggcgatcgcgcggtattgctgtttcccagcggcccggactacgtcgcggcg
ttcttcggttgcctgtacgccggggtgatcgcggtgccggcctatccgccggaatccacc
cgtcgtcatcaccaggagcgcctgatttccatcatggccgacgccgagccacggttgctg
ctgaccagcgccgggctgcgggattcactgttgcagatggacgaactcaaggccccaggc
gcgccgcaactgctgtgtgtggacaccctgcaagccgggctggccgaagactggcaggcc
gtggcgctgcagggcgacgacatcgccttcctgcaatacacctcgggctccaccgcgctg
cccaaaggcgtgcaggtcagccatggcaacctggtggccaacgaactgctgatccgtcgc
ggcttcggtatcgacctcaacccggacgacgtgatcgtcagctggctgccgctgtaccac
gacatgggcttgattggcggcctgctgcaaccgattttcagcggcgtgccctgtgtgctg
atgtcaccggcctacttcctggcgcggcccgtacgctggctggaagcgatcagcgaatac
ggcggcaccatcagcggcggcccggatttcgcctaccgcctgtgcagcgaacgggtcagc
gagtcggccctggagcgcctcgacctcagcggctggcgcgtggcctattcggggtccgag
ccgatccgcctggacaccctggagcgtttcgccgagaagttcagcgcctgcggtttcagc
catgaaaacttcctcgcctcctacggcctggccgaagccaccctgttcgtggccggtggc
gtgcgcggccagggcatcccggccctgcacctggacgaccaggccctggcgcagaaccgc
gccgagccggggcagggcagcgcgatgatgagctgcggcttcagccagccggaacacgcc
gtgctggtgatggatccgcagcaactgggcgaattgcctgacaaccgtattggcgaagtc
tgggccgccgggccgagcattgcccatggctactggcgcaatcctgaagccaccgccaag
accttcgtccagcatgccggtcgtacctggttgcgcaccggtgacctgggctttatccgc
gatggcgagctgttcatcaccgggcgcctgaaggacctgctgatcgtgcgcgggcacaac
ctctacccccaggacatcgaaaagaccatcgagcgcgaggtggaagtggtgcgcaagggc
cgggtggcggcgtttgcggtcaccgagcagggtcaggaaggcatcggcatcgccgcggaa
atcagccgcagcgtgcagaagatcctgccccccgaggcgctgatcaaggccatccgccag
gcggtggccgaagcctgccaggaagcgccgagcgtggtggtgctgctcaaccccggggcc
ctgccgaaaacctccagcggcaagttgcagcgttccgcctgccgcacgcggctggccgat
ggcagcctggattactacgcgctgttcccgcaggccggcagcgaacccgcccgcgtcggc
gaaggttctggcgatgagctgcaaaacctgatcgggcggatctggcaggaacagctgcaa
tgcgcttcagtggcggccgacgatcacttcttcctcctggggggcaactcgattgccgct
acccaggtgatcgcccgcctgcgtgaagagctggggctggaactgggcttgcgcctgctg
ttcgaggctccgaccctgggtgccttcagcgctgccgtggcgcgccagcagcaggacggc
ggcgtggcccagggcagtatcaatgccctgtcgcgccagcagccgctgccccaatccctg
gcgcagaaccgcctgtggatcacctggcaactggacccgcagagcagcgcctacaacatt
cccggcggcctgcgcttgcgtggcgagctggatgaagaggccctgcgcgccagcttccag
caactgatccagcgccacgaagcgctgcgcacgcgcttcttcgagcgtgacggccaggcc
ctgcaacaggtggatgccgccggcgaattcaacctgcaggtgatcgatatcagcgacctg
ccaccggccgagcgtgaagcccgggcgcggcagatccgcgaagacgaggcccggacccag
ttcgatctggagaaggggccgctgtactgggcgaccctggtgcgcctggatgacgaagaa
caccaactgctgctgaccctgcaccacatcatcgccgacggctggtcgctgaatgtgctg
atcgacgagttctcgcggctctatgccgccgcggcccagggccagagcctggagctggcg
cccctggccctgcaatacgccgactacggcagctggcagcgccagtggctggcccagggc
gaaggccagcgccagctggactactggaaacagcagttggcggacgaagccccggtgttg
aacctcgccaccgaccacccgcgttcggcccaggtccgccacagcgccgcgcgccatgac
ctgcgcctgagcgcgagcctcagtgaagccgtgcgccagaccgcccaggctcggcaggcc
acgccgttcatgctgttgctggcggcgttccagaccctgctgcaccgctacagcgggcag
ggcgatatccgcatcggtgtgcccaacgccaaccgcccgcgcctggagacccagggcctt
ctgggctttttcatcaacacccaggtattgcgcgggcagttggattcgcgccagtccttc
gccgacctgctgcagcagacccgccgcaccgccctggaggcccaggcccaccaggacctg
cctttcgaacaattgctcgaagccttccccgaagcccgtgagcagggcctgttccaggtc
atgttcaaccaccagcagcgcgacctcagtgccttgcgccgcctgccggggctgctggcc
gaagagctgccgtggcacagccgcgaggccaagttcgacctgcaactgcacagcgaagag
gaccgcaacggccgcctgagcctggccttcgactacgccgacgagctgttcgacgcggcc
agcatcgagcgtctggccgggcatttcatcagcctgctggagcatgcctgcctgcaaccg
gactgcgccctgggcgacttgccgttgctcggcaacgccgaagcggcgcaactgcagcaa
tggagcgtggccccctgcgcgccggccgagcagtggctgccggagcgcctgcacgaacaa
ctgcgccagagcccggaacgcaccgcgctggtctgggacggcggccagctgggctttgcc
gaactgcacgcccaggccaaccgcctggcccattacctgcgggacaagggggtcggcccg
gacgtgtgcgtggccatcgccgccgaacgttcgccgcaactgctgatcggccttctggca
atcatcaaggccggtggcgcctacgtgcccctggacccggactaccccgccgaacgcctg
gcctacatgctcggcgacagcggcgtgcaactgctgctgacccagacccatctgctgggc
cggatgcccgaagccccgggtgtcagcgccatcgccatggacagcctcaagctcgacagc
tggccgagccacgcgccgggcctgcacctgcacggcgaacacctggcctacgtgatctac
acctccggttccaccggccagcccaagggcgtcggcaacacccatcgcgcgctgatggag
cgcctgcaatggatgcaggacagctaccagctgcaagccgacgatgtgctgatgcaaaaa
gcccccatcagcttcgacgtgtcggtgtgggagtgcttctggccgttgatcaccggctgc
cgcctgctgatcgccgcccccggcgagcaccgcgatccccatcgcatcgcccagctggtg
caggagtacggcgtcaccacgctgcacttcgtgccgccgctgttgcagttgttcgtcgat
gagccgctgagcgccgaatgccacagcctgcgccgggtgttctccggtggcgaagccctg
ccggccgagctgcgcaatcgcctattgcagcagttgcccaacgcgcaactgcacaaccgc
tacggccccaccgaaaccgcgatcaacgtcacccattggcagtgttcggtggatgacggc
gagcgctcgcccattggccggccgctgggcaatgtgctgtgccgggtgctggatgccgag
ctcaatctgatgcccgccggggtgcccggcgagctgtgcatcagcggccagggcctggcc
cggggttacctgggacgcccggcgctgaccgccgaacgctttgtggtcgaccccctgagt
gaggagggcgcgcgcctgtaccgcaccggtgaccgcgtacgctggtgcgccgacggcgtg
ctggaatacctcggtcgcctcgaccagcaggtcaagctgcggggctttcgggtcgagccg
caggaaatcgaagcgcggctactggcccaggacggcgtggcccaggccgcggtgctggtg
cgcgataccgtcgccggcccgcagttgatcggctactacaccgcccaggccagcgacgaa
gatgaaaccgagcaaagcgcccggctgaaaactgccctggccgccgagctgccggaatac
atggtgccggcgcaactgctgcggctggacgccatgcccctgagccccagtggcaagctc
gaccgccgggccctgccggagccgcaatggctggtgcgcgagcacgtcgaaccgagcacc
gaactggaacaacagatcgcggctatatggcgcgaagtgctgggccagccacgcatcggc
ctcaaggacgacttcttcgccctgggcgggcattcgctgctggcgacccagatcatttcc
cgcacccgccaggcctgcgacgtcgaactgccgctgcgggcgctgttcgaagccagcgaa
ctgggggcctttgccgagcaggtgctgctgatccagcagtccggcgcgcgcaaccagcaa
ccgccgattgcccgggtcgaccgcagccagccggtgccgctgtcctattcccagcagcgc
atgtggttcctctggcagatggagcccgacagcccagcctataacgtcggtggcatggcg
cggctgtctggcgtgctcgacgtgggccgcttcgaggccgcgctgcaagcgctgatcctg
cgtcacgaaaccctgcgcaccaccttccctagcgtcaatggcgtggcccatcagcaggtg
catgccgacaccggcctgcgcatggcctggaaggacttctcggccctggccccggatgcc
cggcaacaacgcctgcaacaactggcggacagcgaagcgcaccagcccttcgacctggag
accggccccttgctgcgcgcctgcctggtcaaggccggcgagcaggagcattacttcgtc
ctgaccctgcaccatatcgtcaccgaaggctgggccatggacatcttcgcccgcgagctg
ggcgcgctgtacgaagccttcctcgacgaccgcgaatcgcccctggaaccgctgccggtg
cagtacctggactacagcgtgtggcagcgccagtggctggaatccggcgagcgccagcgt
cagctggactactggaccgggcaactgggccgcgaacacccgctgctggagctgcccagc
gaccggccacgcccggcggtgcaaagccaccagggcgagctgtaccgcttcgatttgagc
gacgaactggcggcccgggtgcgcgccttcaatgccgagcacggcctgaccctgttcatg
accatgaccgccgcgttgtcgctgctgctctatcgctacagcggccagagcgacctgcgc
atcggcgcgccggtggccaaccgcatccgtccggaaagcgaagggctgatcggcgccttc
ctcaacacccaggtgctgcgttgccagctcgacgggcagatgagcgtcagccagttactg
gagcaggtgcgccacaccgtgatcgagggccagtcccaccaggacctgccgttcgaccat
ctggtggaagccttgcaaccaccgcgcagcaccgcctacaacccgctgttccaggtgatg
tgcaacgtccagcgctgggaattccagcaaagccggcagttggcgggcatgaccgtggaa
tacctggtcaacgatgcccgggccaccaagtttgacctcaacctggaagtcaccgacctg
gatcagcgcctgggctgttgcctgacctacagcaccgacctgttcgacgagccgcgcatt
gcgcgcatggcggcccattggcgcaatctgctggaggccttgctcagcgatccgcaacag
cgtctgtgcgaattgccgctgctgcacgccgaggaacagcagcaactgctggacagcttg
agtgtcgagcctggcgagcaacgtctggaccagtgcatccaccacctgttcagcgaacag
gccctggcccgcaaggacgcaccggccctgaccttcgccggacagaccctgagctacagc
gaactggacagccgcgccaaccgcctggcctggatgcttcgcgagcgtggcgtgggcccg
caagtgcgggtcggcctggccctggagcgctccctggaaatggtcgtcggcctgctggcg
atcctcaaggccggtggcgcctacgtgcccctggacccggaataccccctggatcgcctg
cactacatgatcgaggacagcggcatcggcctgctcctcagcgatgcgcggatgttcgcc
gccctgggtgagttgcccatcagtgtaggccgctggtgcctggaggaagacggcgcgctg
ctggccgactacccggccggcgaattgcccttcatcagcctgccccagcatcaggcgtac
ctgatctacacctccggctccaccggccagcccaagggcgtggtggtgtcccacggggaa
attgccatgcactgccaggcggtgatccgtcgtttcggcatgcgcgcggacgattgcgag
ctgcacttctattccatcaacttcgacgccgccaccgagcgcttgctggtgccgctgctc
agcggtgcccaggtggtgctgcgggcccagggccagtgggacgccgaggaaatctgccag
ctgattcgtcagcatcgcatcagcatcctcggtttcaccccgagctacggcagccagttg
gcccagcatctggcgacccagcagcagaccctgccggtgcgcatgtgcatcacaggcggc
gaggccctgaccggcgaacacctgcagcgcatccgtgcggccttccagccgagcctgttc
ttcaacgcctacggccccaccgaaaccgtggtcatgcccttggccagcctggcgccggag
caattggcggacggcgtggccagcgtgccgatcggccgcatcgtcggggcccgggtggct
tacattctcgatgccgatctggcgctggtgccccaaggggcgaccggtgagctgtatgtc
ggcggcgccggtctggcccagggttatcaccgtcgtccggggatgagtgccgagcgtttt
gtcgccgatccgttcgccacagatggcgggcgcctgtaccgcaccggggacctggtgcgc
cagtgcgccgacggccaggtggaatacatcggccgggtggaccatcaggtgaagatccgc
ggtttccgcatcgagctgggggaaatcgaaacccgcctgctggatcatccggccgtgcgt
gaagcggtggtgctggccttggataccccggccggcaagcagctggctggttacctggtg
accgaggtggccgagcacaacgatgtgcagcaggccaacctgcgtgaagccctcaagcag
cagctgaaaacccagctgccggactacatggtgccgacccacctgatcctcctggccagc
atgccgttgaccgccaacggcaagctcgaccgccgggccctgccattgccggacccggag
ctcaaccgccagcagtacgtggcgccgagcaatgagctggaacagaccctggccggggtc
tggggcgaagtgctgaacgtgcagcaagtgggcctcaacgacaatttcttcgaactgggg
ggcgactcgatcctgtcgatccaggtggtcagccgtgcccgccagttggggattcacttc
accccgcgggacctgttccagcaccagaccgtgcagaccctggcgcgggtcgccagccac
actcagcgcgtcagcgccgagcagggccagctcagtggcgaagcgtcgctgacgccgatc
cagcactggttcttcgacagccgcattccccagccgcagcactggaaccaggccttgttg
ctggaaccgctgggcaccctggatgggtcgttgctggagcaagcgctgctggcggtgctg
gagcagcacgacgccttgcgcctgcgtttctctcaggcaggtgggcaggcaggcgggcaa
tggcgcgccgagtacctgccgttgtccgatgctcccttgctctggcaggtgcgggtgccg
tccatggccacctgcgaggcactgttcgccgatgcccagcgcagcctcgacctggaacac
gggccgctgctgcgggcggtgctggtggacggccctgaaggcgagcaacgcctgttgctg
accatccaccacctggtggtggacggtgtgtcctggcgcgtgctgctggaagatctgcaa
aacgcctatcgtcagttgcaagccgggcaggccctgaagctgccggccaagaccagtgcc
ctgcgggactggtcgagccgcctgcaagcctatgccggcagcgagtccctgcgtgaagag
ctcggctggtggcagcagcaattggccggcccggccgcgcaactgccggggctcaaggcc
actggcagccagcagcatcaacaggctcaaagccacagcgtgaccctggatgccgagcgc
acccgtcagttgctgcaacaggctccagcggcctaccgcacccaggtcaacgacctgctg
ctgaccgccctggcccgggtgctgtgtcgctggagcgggcagccttcggccctggtgcaa
ctggaaggccacggccgcgaggcgctgttcgacgagatcgacctgactcgcaccgtgggt
tggttcaccagcgcctatccgctgcgcctgacgccgttgcaggtggaagaagcggccggg
cagggcgcctcgatcaaggccatcaaggaacaactgcgggccgtgccgcacaagggcctg
ggttacggcgtgctgcgctacctggcggatgaaagctgccgcgaggccctggcagcgctg
ccgctggcgccggtgaccttcaactacctggggcagttcgaccagagtttcggtaccgat
gcactgttgcgcccgttggatgaatccgtcggcccggcccatgcaccggaagcaccgttg
cccaacgaactgagcatcgacagccaggtgtatggcggcgagctggtgctgcgctggacc
tacagcagcgaacgtttcgacgccgagctgatcagcgagctggcgagcgcctacctgggc
gagctgcagagcctgatcggccattgcctgaaggacgatgccggtggcctgacgccgtcc
gacttccccctggcgcgcctgacccaggcccagctcgatggcctgccggtaccggcggcg
cagatcgaagacgtctacccgctgaccccgatgcaggagggcatgctgttgcacaccctg
ctggagccgggcaccggcctgtattacatgcaggaccgctaccgcatcaacagcgaactg
gacccggagcgtttcgcccaggcctggcaggcggtggtggcgcgccacgaagccttgcgc
gcgtctttttgctggaacgtcggcgaagacatgctgcaagttatccacaagccgggccgc
accccgatcgagtttctcgactggagcgcggtgcccgaggccgagcaggaagccaagctg
caagccctgcacaaacaggagcgtgaggccggcttcgatctgctcaaccaggcgccgttc
cacctgcggctgatccgcgttggtgcggcccgttactggttcatgatgagcaaccaccac
atcctcatcgatgcctggtgccgctcgctgctgatgaacgacttcttcgagatctacacc
gccctcggtgaaggtcgcgaggcgcaactggcggtgccaccgcgttaccgcgactacatc
ggctggctgcaacaccagagcctgtccgaggcgcggcagtggtggcggcagaaccttgag
ggctttgaacgcaccacgccgatccccagcgaccggccgttcctgcgcgaacacgccggt
gacagcggcggcatgatcgtcggcgactgctacacccgcctggatgcccgggatggtgcg
caactgcgggaactggcgcagcagcaccagctcaccgtcaacaccttcgcccaggcggcc
tgggccctggtgctgcggcgcatgagcggcgatcgcgacgtattgttcggggtcaccgtg
gccgggcgcccggtggaaatgccggagatgcaacgcaccgtcggcctgttcatcaacagc
atcgccctgcgggtcaagctgccccaggacggtgagcgctgcagcgtgcgccagtggctc
agcggcttgctcgacagcaacatgcagctgcgcgaatacgagtacctgccgctggtggcg
atccaggaaaccagcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttc
gagaacgcgccggtggaagtctcggtgctggaccgtgcccagagcctgaacgccagttcg
gattccggccgtacccacaccaacttcccgatcaccgcggtgtgctacccgggggatgac
ctgggcctgcacctgtcctacgaccagcgctacttcgagcaggcgaccatcgagcgcatg
ctcggcgagttcaagcgcctgctgctggccctgatgcagggctttcatggcgacatggcc
gaactgccgctgctgggcgaagaagagcaggacttcctgctggccggctgcaaccagagc
gagcatgagtacccgctggagcgcagctacgtggaactgttcgaggcccaggtggcggct
catccgcaacgcatcgccgccagttgcctggaccagcgttacagctatgccgagttgaac
cgctgcagcaaccgcctgggccacgccctggttgccaacggcgtgggctttgatcagccg
gtggccctgctggccgagcgcggcctggaactcttgggcatgatcatcggcagcttcaag
gccggggccggctacctgcccctggacccgggcctgccgggccagcgcctgggccgcatc
atcgagctcagccgcacgccgatcctggtctgcaccgcggcctgccgcgaacaggcccag
gccctgctggacgagttcggctgtgccgggcgtccgcggctgctggtctgggaagagctg
caagccgccgggcatgccgagcacaacccgggccgctacagcgcgccggacaacctggcc
tatgtgatctacacctccggttccaccggcctgcccaagggcgtgatggtggagcagcgc
ggcatgctcaacaaccagctgagcaaggtgccgtacctgcacttaagtgaggccgacgtg
atcgcccagaccgcgtcccagagcttcgacatttcggtctggcagttccttgccgcaccg
ctgttcggcgctcgggtggacatcgtgcccaacaccatcgcccacgatccccaggggctg
ttggcccacgtcgaggagcagggcatcacggtgctggagagcgtgccgtcgctgatccag
ggcatgctcgcccaggacgccatcgccctggatggcctgcgctggatgctgcccaccggc
gaggccatgccgcccgagctggcgcaccagtggctgctgcgttatccacaggtcggcctg
gtcaacgcctacggcccggcggagtgctccgatgacgtggccttcttccgtgtcgatatg
gcctcgacccgtggcgcctacctgcccatcggcacgcccaccgacaacaaccagttgtac
ctgatggacgaagccctggagctggtgcccctgggagcggtgggtgaattgtgcgtggct
ggcaccggtgttggccgtggctacgtcagcgacccgttgcgtaccgcgctggccttcgtg
ccccatccgttcggtgcagcgggcgaacgcctgtaccgcaccggcgacctggcacgccgg
cgcagcgacggcgtactggaatacgttggccgcattgaccatcaggtgaagatccgcggc
taccgcatcgagctgggggaaatcgaagcgcgcctgcatgaacagccggaattgcgcgat
gccgccgtgggcgtgcaggagggcgtcaacggcaagcacctggttgggtacctggtggcc
agtgacacgaacctgagcccgagcgaatgcctggagcggatcaagccgcggctgcgcgcc
gaactgccggaatacatggtgccgctgcactggttgtggcttgcgcacctgccgctcaac
gccaacggcaagctcgatcgcaaggccctgccggccctggagatcggccagctgcagagc
caggactacctggccccgggcaatgagctggagcaaaccctggcggacatctgggccgag
gtgctcaaggtcgaacgggtgggcgtgcgcgacaacttcttcgagttgggcgggcattcc
ctgctggcgacccagatcgcttcacgggtacagaagaccctgcaacgcaacgtgccgctg
cgggccatgttcgaatgcagcacggtgcaggagctggccgcgtacatcgacggcctgggg
gccaatgaaatcagcgaggagaaagtggatcggctgagcgacctgatggccgaactggag
gggctgtga

DBGET integrated database retrieval system