KEGG   Pseudomonas protegens Pf-5: PFL_4675
Entry
PFL_4675          CDS       T00249                                 

Gene name
pilL
Definition
(GenBank) putative type IV pilus biogenesis protein PilL
Organism
pfl  Pseudomonas protegens Pf-5
SSDB
Motif
Pfam: TcpQ
Other DBs
NCBI-ProteinID: AAY93918
UniProt: Q4K7M5
LinkDB
Position
5399717..5400862
AA seq 381 aa
MIRQLTTLSLVALIAGCASQKAESPKPTSAFDSSRNPEWLSPDLYPNGAVPAKEPVVRYG
RYTLVSTEPGSSQRDLMAQIIDVTIPSGMSPSIRDAMLYVVDRSGYTLCSPSTPHVNILY
TRPLPAAQYKLGPMTLRNTLQVLAGPAWQVKVDEVNRQVCFVLRPGYQLPDPVASSAQLY
AAKSPTTLPPAPPSADKASTVVVTAVPSASAITAVTPAGVQESSATTQTLSPVVPAKDGP
TIHKAVPSVAPSSSAVPITSLASSSAEASKKAVPAVTTAPQKSPIPNPTPVPAKPLPEIW
AASTGSTLRQSVEAWAQKANWTLLWEPEDLDYPIAAPLRFEGSFEEAIKQVFPLYDKAPR
SFVVDGSAAQRLIHIAERKKK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatcaggcagttgaccactctctcgcttgtcgcactcatcgcaggctgtgcgagccaa
aaggctgaatcacccaagccgacatccgcgttcgatagcagtcgcaatcctgagtggctg
tctccggacctgtatcccaatggtgctgttccagcgaaagaacccgttgttcggtacggc
cgctacaccctggtcagtaccgaacctggttccagccaacgggacctcatggcccagatc
atcgacgtgactatcccctcagggatgagcccaagcattcgagatgccatgctctacgtc
gtggaccggtcgggttacacgctctgctcaccgagcacgcctcacgtcaacatcctgtac
acccgccctcttccagcggcccagtacaagcttgggcctatgacgttgcgcaacacgctg
caggttctggccggccctgcctggcaggttaaagtcgatgaggtgaatcggcaggtctgc
tttgtactgcgcccgggataccagctaccagatccggtcgcctcatctgcgcagctctat
gccgctaagtcgccgaccacactgccaccggcgcctccatctgctgacaaggccagtacc
gttgttgtaaccgccgtgccttccgcctcggcaatcacagctgtaacgccagcgggtgtg
caggaatcatccgccaccacccaaacgctttccccagtggtacccgccaaggacggccct
actatccataaagcggtgcccagcgtggctccgagctccagtgctgtaccaattacgtca
ctcgccagttcctctgcagaggcttcgaagaaggccgtacctgcagttaccactgcgcct
caaaagtcccccatcccaaacccgacgcccgtgcctgcgaagcctctgccggagatctgg
gcggccagtaccggatcaactcttcgccagagcgttgaggcctgggcacagaaggctaac
tggacgttgctgtgggagccggaggacctggactacccaattgctgctccattgcgcttt
gaaggctcgttcgaagaagcaatcaagcaggtgttccccctctacgacaaagcgccgcgc
tcattcgtagtcgatggcagcgctgcacagcggctcatacatatcgctgagagaaagaaa
aaatga

DBGET integrated database retrieval system