KEGG   Pseudomonas protegens Pf-5: PFL_5059Help
Entry
PFL_5059          CDS       T00249                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00473  D-Alanine metabolism
pfl00550  Peptidoglycan biosynthesis
pfl01100  Metabolic pathways
pfl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PFL_5059 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFL_5059 (ddlB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PFL_5059 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfl01011]
    PFL_5059 (ddlB)
Enzymes [BR:pfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PFL_5059 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pfl01011]
 Precursor biosynthesis
  Amino acid ligase
   PFL_5059 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK GARS_A ATP-grasp_5 ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AAY94287
UniProt: Q4K6J5
LinkDB All DBs
Position
complement(5820200..5821156)
Genome map
AA seq 318 aa AA seqDB search
MTAAYANLFSTVKPSDFGRVAVLYGGKSAEREVSLKSGKAVLEALQSGGVNAFGIDVGDD
LLQRLLSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLSSEADCISAVAELGLPLIVKPAHEGSSIGMAKVTSASELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDSS
KEQELMELTAKACEALGIAGWARADVMQDAQGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASLEARG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgcctacgccaacctgttctctaccgtgaaaccgagcgatttcggtcgcgtc
gccgttctttacggtggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaaggcc
gtgcttgaagcgctgcagagcggcggtgtgaacgccttcggcatcgacgtcggcgatgat
ctgctgcaacgtctcttgagcgagaagatcgatcgtgccttcatcattctccacggtcgt
ggcggtgaagacggcagcatgcaagggctgctggagtgcctggggattccttacaccggc
agcggcatcctcgcttcggccctggccatggacaaactgcgtaccaagcaggtctggcac
agcctgggcattccgacgccgcgccacgccgtattgagctccgaggccgattgtatttcc
gcggtggcggaactgggcctgcctttgatcgtcaaaccggctcatgaaggctccagtatc
ggtatggccaaggtgacttccgcgtccgaattgatcgacgcatggaaggcggccagtacc
tacgattcgcaagtgttggtcgagcaatggatccagggtccggagttcaccatcgcgacc
ctgcgtgaccaggtgctgccacccatcgccctgggcactccccacacattttacgactac
gacgccaagtacctggcttccgatacccagtaccggatcccgtgcgggctcgacagctcc
aaggaacaggaactcatggaactcacggcgaaagcctgtgaggcgcttggtatcgccggt
tgggcacgtgccgacgtgatgcaggacgcccaggggcagttctggttcctggaagtgaac
accgctccgggcatgaccgatcacagtctggttccgatggcggcccgcgcggccggcctg
gatttccagcaactggtattggccatcctggcagccagtcttgaggcgagaggttaa

DBGET integrated database retrieval system