KEGG   Phytohabitans flavus: Pflav_059810
Entry
Pflav_059810      CDS       T06516                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
pfla  Phytohabitans flavus
Pathway
pfla00997  Biosynthesis of various secondary metabolites - part 3
pfla01100  Metabolic pathways
pfla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfla00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Pflav_059810
Enzymes [BR:pfla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     Pflav_059810
SSDB
Motif
Pfam: DeoC OMPdecase pXO2-72
Other DBs
NCBI-ProteinID: BCB79571
UniProt: A0A6F8Y0S3
LinkDB
Position
complement(6495217..6496041)
AA seq 274 aa
MTVNNVVGCRIRLQRLYRHDSSSLFVVPLDHSVTDGPITRNGQLNRLIGQLAGNGVDAVV
MHKGALRHVEVGWFRSLSLIVHLSASTRRAPDPDAKYLVSSVEEALRLGADAVSVHVNVG
STTEGQQIADLATVAEACDRWGVPLLAMLYPRGPQIADGRAPELVAHAAAIAADLGADLV
KSALPASAAGIAAVTASCPVPVLAAGGAPSPGANDVMRHLADAMRAGAGGIAAGRLVFTA
ADPAVAARRVAALVHDRTAASGASATYSAPGGAR
NT seq 825 nt   +upstreamnt  +downstreamnt
atgactgtcaataacgtggtcggttgccgtatccggctacagcggctgtaccggcacgat
tcgtcgagccttttcgtggtgccactcgaccattccgtgacggatggcccgatcacacgg
aacgggcagctcaaccgcctgatcggtcagctcgccggaaacggtgtggatgccgtcgtc
atgcacaagggcgcgctccggcacgtcgaagtcggctggtttcggtcgctgtcgctgatc
gtccacctgagcgcgagtacgcgccgcgcacccgatccggacgccaagtacctcgtgtcc
tctgtggaggaggcgctgcggctcggtgcggacgcggtgagcgtgcacgtcaatgtcggg
tccaccacggagggtcagcagatcgccgatctggctacggtcgccgaggcgtgcgaccgc
tggggcgtaccactgctggcgatgctttacccacgcggaccgcagatcgccgacggccgc
gcgccggagctcgtggcgcacgcggccgcgatcgcggccgacctcggcgcggacctggtc
aagtcggcgctgcccgcctcggcggccgggatcgcggcggtcaccgcgagctgcccggta
ccggtcctggccgccggtggcgccccgtcacccggcgcgaacgacgtcatgcgccacctc
gccgacgcgatgcgggcgggcgcgggcggcatcgccgccgggcgcctcgtcttcaccgcc
gcggatccggcggtggccgcccgccgcgtcgccgcgcttgtccacgaccgcacggcggcg
tccggtgcgagcgctacctactcagctccaggaggggcccgatga

DBGET integrated database retrieval system