KEGG   Pyrolobus fumarii: Pyrfu_1129Help
Entry
Pyrfu_1129        CDS       T01620                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP NADH_4Fe-4S NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AEM38995
UniProt: G0EFH1
LinkDB All DBs
Position
complement(1065571..1066584)
Genome map
AA seq 337 aa AA seqDB search
MTRMRIAVLQEPFSIVLREVEVPKLDSRSVLVRVASCALSGTDVRIYKGVVKTRLPIVLG
QEFSGVVVEVGDEVEGVSRGEKVVVEPVLYCGKCVYCRRGLYTLCEQVKVLGVNSDGGLA
EYVKVPAYAVHRVPAGLSLEEACLTVPVAVALHAVRRAGVGIGDNVLVFGAGAIGLSALQ
LARLSGADRVVVVEPVESKRRLAERLGAHETLSPRDMEALGDGAERRLGRFDVVIETSGS
VDALRHALMLVGKRGRIVVVGAYGREARLLVDLVVRREVTVTGSWLYPHVFRKALDAIAR
GIVSVKEYISGRYPLARIEEAFREALKPENIRIIVQP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgacgagaatgaggatagctgttctccaggagccgttctccatcgttttgagagaggtt
gaggtgcccaagctggactctaggagcgtcctggtgagggtggctagctgcgcgcttagc
ggcaccgatgtcaggatatacaagggtgttgtgaagacgaggttgcctatcgtattgggc
caggagtttagcggtgtagtagtggaggtgggcgatgaggttgagggggtttcgagaggc
gagaaggttgtggtagagccggtgctctactgcggcaagtgcgtgtactgcaggaggggt
ctctacaccctatgcgagcaggtgaaggtcctcggagtcaatagtgatggtggtcttgcc
gagtatgtcaaggtacccgcgtacgctgtccatagggtccctgcgggcctcagcctcgag
gaggcttgtctcaccgtcccggtggccgtggcactccacgctgtcaggagggcgggggtg
ggcataggcgataacgtgctggtctttggtgccggtgctataggtctctcggctttacag
ttggccaggctctctggcgccgatagggttgttgttgtggagcccgtggagtctaagcgt
aggctcgcagagaggctcggagctcacgagacgctctcgcccagggatatggaggcgttg
ggagatggcgccgagaggaggctggggaggttcgacgttgtgatagagacctcggggtct
gtggacgcgttgaggcatgcgcttatgctcgtgggtaagagaggtaggatcgtcgtggtg
ggagcctatggtagggaggctaggttgctcgtggatctagtcgttaggagggaggtgacc
gtcacgggctcgtggctatacccgcacgtgttccgcaaggcactggatgcaatcgcgagg
gggatagtctccgtgaaggagtacatatctggcaggtaccctctcgcgaggatagaggag
gcgttcagggaggcattgaaaccggagaacatcaggatcatagtccagccgtga

DBGET integrated database retrieval system