KEGG   Pyrolobus fumarii: Pyrfu_1465Help
Entry
Pyrfu_1465        CDS       T01620                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pyrfu_1465
Enzymes [BR:pfm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pyrfu_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase DNA_ligase_A_M Bacteriocin_IIi Radical_SAM AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEM39323
UniProt: G0EH99
LinkDB All DBs
Position
complement(1376757..1377929)
Genome map
AA seq 390 aa AA seqDB search
MIRIPLERWMIEKLAEALNVNIEEAERLARRRNVVRLMKWRNVTYFSLRKDVYGLREGTL
IAVWPDGYRVVPGYPSIQRVLLPSVALPKHFIDKIVVEEKLNGYNVRVVKLRDEIVAVTR
GGLICPYTTQRIRKLYGDKLTSLFREEGEELVVAGEVIGLENPYVRFYYPEAGGFAYFIF
DIVHGEKFLPPHERKEIVEKHGLLHVPVLGEIDKNDIKAFRKIIEDLERRGREGVVLKDP
EYRVPPLKYTTSFINIHDIEIGMRFPFDEGRNYLFSRILREIFKAVEEGWDDRRLLLAEQ
NLGKAILEPAIEAVKEVKNGKMLYEEFMLPFDTRDDFEEFLDYMASLGVDIIVAGVEQRS
DGSIVARIRKVKDTWREVQKILETGLSPID
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttgatacgtatacctctagaaaggtggatgattgagaagctagcagaggcgcttaacgtg
aatattgaggaggccgagcggcttgcacgaagacgtaacgttgtgcgtctaatgaaatgg
aggaatgtcacatacttctctctgcgcaaggacgtttacggtctacgtgaaggcacgcta
atagccgtatggcctgacggctaccgtgtagtcccaggatacccgtctatacagcgagtg
ctcctcccgagtgtagcgctgcccaaacacttcattgataagatagttgttgaggagaag
ctgaatgggtataacgttagagttgttaaactacgcgacgagatcgttgctgtaacaaga
ggcggtcttatctgtccatacacgacgcagcgtatacgtaaactctacggtgataaacta
actagcctattccgagaggagggcgaggaactcgtagtagccggtgaggtcatagggcta
gagaatccatacgtgcgcttctactaccccgaggccggagggtttgcctatttcatcttc
gatattgtacatggtgagaagtttctgcctccacatgagcgaaaagagatagttgaaaag
catggattgctacacgttcccgtgctaggtgagatagataaaaacgatatcaaggccttc
aggaagataattgaggatcttgaacgacgtggaagggagggtgttgtccttaaagaccca
gagtatcgagtcccacccttgaaatacactacgagcttcataaacatacacgacatcgag
attggtatgagattcccgtttgatgagggtagaaactacctcttctcacgaatactacgt
gaaatattcaaggctgtggaggagggatgggatgataggcgtttgttacttgcagagcag
aacttggggaaggctatcctggagccggccatcgaggctgtaaaggaggttaaaaacggt
aaaatgttgtatgaggagttcatgttgcctttcgatactagagacgattttgaagagttc
ctggactacatggcgtctctaggtgttgacatcatagttgctggggtagagcaacgtagt
gatggtagtattgtcgcgaggataagaaaggttaaggatacgtggcgcgaggtgcagaag
atactagagacagggctaagtcctattgactaa

DBGET integrated database retrieval system