KEGG   Pyrolobus fumarii: Pyrfu_1818Help
Entry
Pyrfu_1818        CDS       T01620                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K17487  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase [EC:3.1.4.56]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00790  Folate biosynthesis
pfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pyrfu_1818
Enzymes [BR:pfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.56  7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase
     Pyrfu_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD TraI_2 HD_2
Motif
Other DBs
NCBI-ProteinID: AEM39672
UniProt: G0ECV2
LinkDB All DBs
Position
1697790..1698542
Genome map
AA seq 250 aa AA seqDB search
MCALSISFEERARRIHERLLEIAEKEINDEKIRSITVELLREPKITFVRVEPRISFYESP
AAPKNHHSYPGGLLDHTLGVTEIAMQLIKVYRDVYGATVNKDIVVAAALLHDLFKYYQYE
KDPLTGGYRPRSDWYLSHEFAMVSELYKRGAPDPLVRAIAEAHGTTPFTMVESQIVHQAD
STDSQFVSKLQDVVWRACLDLELEVEGVRAIKIFHEAMKRAPIFEYAKVYYSQGRDGLRE
YIKKLLGLAP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgcgttgagcatctcgttcgaggagagggctagaaggatacatgagaggctccta
gagatagccgagaaggaaatcaacgacgagaagatacggtcgattaccgtagagctccta
cgcgagcctaagataacattcgtgcgtgtcgagccacgcatcagcttctacgagtcacca
gcagcccccaagaaccatcactcatacccaggcggtctactagaccacaccctgggcgtc
accgagatagcgatgcagctaatcaaggtataccgcgacgtgtacggcgcaaccgtcaac
aaagatatcgtggttgctgctgcgctactacacgacctcttcaagtactaccagtacgag
aaggacccgctaacgggcggctaccgtccaaggagcgactggtacctaagccacgagttc
gcaatggtatccgagttatacaagaggggcgcgccagaccccctagtgagggccatagca
gaggcccacggcaccaccccattcaccatggtcgagtcccagatagtacaccaggctgac
agtaccgactcccagttcgtatccaaactccaagatgtagtgtggagggcgtgcctggac
ctcgagctggaagtcgagggcgtgagggcgatcaagatattccacgaggccatgaagaga
gcgccgatattcgagtacgcaaaggtgtactacagccagggtcgtgacgggctacgcgag
tacatcaagaagctcctcggcctagcgccgtga

DBGET integrated database retrieval system