KEGG   Pseudomonas fluorescens UK4: HZ99_02330Help
Entry
HZ99_02330        CDS       T03319                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfn  Pseudomonas fluorescens UK4
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HZ99_02330
Enzymes [BR:pfn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HZ99_02330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIG01067
UniProt: A0A379ID21
LinkDB All DBs
Position
535122..536675
Genome map
AA seq 517 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVASLTTLITLKTDGNDGR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQVMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGSEKAAEKISAKDAFDVLVVGGGPAGSAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLVPAKNPGE
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTIDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggtgcgaaatcccaggaaatgcttgcccttttg
caggatgtagccagcctcaccacgctgattaccctgaaaaccgatggcaatgatgggcgc
aaaccgtcgttctccatcaaccgcccgggtgccgatatcagcctgcgtttcgccggcatc
cccatggggcatgaattcacttcgttggtgctggccctgctgcaagtcggtggccaccct
tcgaaggccagtgtcgaagtgattgagcagattcgtagccttaaaggtgagttcagcttc
gagacttacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggctgtactcaacccgaacatccgccacgttgcgatcgatggcgcactgttccaggct
gaagtcgacgagcgccaggtgatggcggtgcccagcgtctacctcaacggtgtgaacttc
ggccagggccgcatgggcctggaagaaatcctcgccaagctcgacaccagcggtagcgaa
aaagcagccgagaaaatcagtgccaaggacgcttttgatgttttggtcgtcggtggtggt
cctgccggttctgcagccgctatctacgccgcgcgtaaaggtatccgtaccggtgtggcc
gctgagcgttttggcgggcaagtgctcgataccatgtccatcgagaactttatctcggtg
caggaaaccgaaggcccgaaactggccagcgccctggaagcccacgtgcgtcagtacgat
gtggacatcatgaacctgcagcgcgccagcagcctggtcccggcgaaaaatcccggcgag
ctgcacgaaattcgctttgaaagcggtgcgactctcaagtccaagactgtgatcctggcg
accggtgcgcgctggcgcgaaatgggcgtaccaggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgatggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggaggcaactctggcgttgaagcggccatcgacctggcgggtattgtcagccatgtg
accttgctggagtttgacagcaaattgcgcgccgacgcggtgttgcagcgcaagctctac
agcttgccgaacgttgacgtgattaccagcgcgctgaccagtgaggtcaaaggtgatggc
cagaaagttaccggcctggcctacaaggaccgcgatagcggcgagttcaagaccatcgac
ctggaaggcatctttgtgcagatcggcttgctgcccaacaccgattggctcaagggtacc
gtcgagctgtcaccccgtggcgagatcattgtcgatgcccgtggcgagacctcactgccg
ggtgtatttgccgccggtgacgttacaaccgtgccgtacaagcagatcgtgattgcggtg
ggcgagggtgccaaggcgtccctgagtgcttttgatcacctgatccgagcataa

DBGET integrated database retrieval system