KEGG   Pseudomonas fluorescens UK4: HZ99_03800Help
Entry
HZ99_03800        CDS       T03319                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00500  Starch and sucrose metabolism
pfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HZ99_03800
Enzymes [BR:pfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HZ99_03800
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     HZ99_03800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AIG01334
UniProt: A0A075P6I9
LinkDB All DBs
Position
complement(885277..888582)
Genome map
AA seq 1101 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSNARDFYVWSDDEQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDQKGDDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPLYGYQSVNVETQAQDPHSLLNWTRRMLAIRKQSKAFGRGSLKM
LSPSNRRILAYTREYTGADGKHETILCVANVSRTAQAAELDLSAFAGMVAVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSLPDFTTLVLKKRLEELLEAPCRT
TLEQTSLPSWLPNRRWFANKDLAIDSVHIAYGVRFGDAQHPVLLSEIEVTSSGQTSRYQL
PFGLLGEDQLTSALPQQLALARVRRVRQVGLITDAFSLDSYIRAVIHGLRARTVLNSSEG
EIRFEPTPQLADLPVGDELQVRYLAAEQSNSSVVVGESLVLKLIRKVSAGIHPELEMGAY
LTTAGYGHISPLLGSVIRHDAQGQDNLLMIAQGYLSNQGDAWAWTQNNLERAIRDELAEA
ISEQEQHYNALGELADFAGLLGQRLGEMHNVLAAPTTNPHFKPEVTSIQDSQGWARQVGA
QIEHALQLLKQHQSQLNPADQGLVTQLLAQKKTIASRVQALAKATVGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARPLEERRGKHSPYKDVSGVLRSFDYAAAMALNVQGQGLDHS
ADADAARQRVTDRYLAEARQAFIQAYQQATSTLAHDWQDAKGADAALALFSLEKAAYEVA
YEAQNRPAWLAVPLRGLHGLL
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggctgccacctttatcaaagacccgctgtggtacaaggacgcg
gtgatttatcaggttcacgtcaaatcctatttcgactccaacaacgacggcatcggtgac
tttcccgggctgatcgccaaactcgactacatcgccgacctgggcgtgaacaccatctgg
ctgctgccgttctacccctcgccacgccgtgacgacggttatgacatcgccgaataccgg
ggagtacacagcgactacgggaccatggccgacgcccggcgctttattgccgaggcccac
aagcgcgggctacgggtgatcacggagctggtgatcaaccacacctccgaccagcatccg
tggttccagcgtgcacgcaaggccaaacccggttccaatgcccgggacttctacgtgtgg
tccgacgacgagcagaaatacgacggcacccgcatcattttcctcgacaccgaaaagtcc
aactggacctgggatccggtcgccggccagtacttctggcaccgtttctattcccatcag
ccggatctcaacttcgacaacccgcaagtcatgaaagccgtgctgtcggtgatgcgctac
tggctggacatgggcatcgacggcctgcgcctggacgcgattccctacctgatcgagcgc
gacggaaccaacaacgaaaacctccccgaaacccacgatgtgctcaagcagatccgcgcc
gagatcgacgccaactaccccgaccgcatgctgctggccgaagccaaccagtggccggaa
gacacccaactgtactttggcgaccagaagggtgacgacggcgacgaatgccatatggcc
ttccactttccgctgatgccgcgcatgtacatggccctggcccaggaggaccgcttcccg
atcaccgatatcctgcgccagaccccggaaatcccggccaactgtcaatgggcgattttc
ctgcgcaaccacgatgagctgaccctggaaatggtcaccgacaaggagcgcgactatctg
tggaactactacgccgccgaccgccgcgcgcgcatcaacctggggattcgccggcgcctg
gcgcccttgatggaacgtgaccggcgccgcatcgagttgctcaacagcctgttactgtcc
atgcccggcacaccgaccctgtattacggtgatgaaatcggcatgggcgacaacatctac
ctgggcgaccgcgacggtgtgcgcacgccgatgcaatggtccatcgaccgcaacggcggg
ttttcccgcgccgacccggccagcctggtgctgccgccgatcatggacccgctctacggc
taccagtcggtcaacgtcgaaacccaggcccaggacccccattcgctgctgaactggacc
cggcgcatgctggcgatccgcaagcagtccaaggccttcggccgtggcagcctgaaaatg
ctctcgcccagcaatcgccggatcctggcctacacccgcgaatacacgggcgccgatggc
aagcacgaaaccatcctgtgcgtggccaatgtgtcgcgcacggcccaggcggcggagctg
gacctctcggcctttgccggcatggttgcggtagaaatgctcggcggcaacgcattcccg
cccattggccagctgaatttcctgctgaccctggccccctacggcttttactggttcgtg
ctcgccgcagaaaaccagatgcccagctggcatgtggaaccggcccagagcctgccggat
ttcaccaccctggtcctgaaaaaacgcctcgaagaattactcgaagcgccgtgccgcacc
accctggagcaaacctcactgcccagctggctacccaaccggcgctggtttgccaacaag
gacttggccattgacagcgttcacattgcctacggcgtgcgctttggcgatgcccagcat
ccggtgttgctcagtgagattgaagtgaccagcagcgggcagaccagccgttaccaactg
cccttcggcttgctgggcgaagaccagctcaccagtgccttgccgcaacaactggccctg
gcgcgagtgcgccgggtgcgccaggtgggcttgatcaccgatgccttcagcctcgacagc
tacatccgtgcagttatccacggtctgcgagcgcggacggtgctcaatagcagcgagggc
gagattcgtttcgaacccaccccgcaattggccgatttacccgtgggtgacgaactgcaa
gtgcgctacctggcggctgaacagtccaatagctcagtggtggtcggtgaaagcctggtg
ttgaagttgatccgcaaggtcagcgccgggattcacccggaactggaaatgggcgcctac
ctgaccacggcgggctatgggcatatttcgcccttgctcggttcggtgatccgccacgat
gcccaaggccaggacaacctgctgatgatcgcccagggctatctgagtaaccagggcgat
gcctgggcctggacccagaacaacctggagcgggccattcgcgatgagttggccgaggcg
atttccgagcaggagcagcactacaacgccctcggtgaactggcagatttcgccgggttg
ctcgggcaacgactgggggagatgcacaacgtcctggccgcgccgacgaccaatccacac
ttcaagcctgaagtcacctccatccaggacagccaaggctgggccaggcaggtgggcgcg
cagatcgagcatgccttgcagctacttaaacagcatcaaagccaattgaaccccgccgac
caggggttggtcactcaactgctggcgcagaaaaagaccatcgccagccgtgtgcaggcg
ttggccaaggccacggtgggcggcctgcgcatccgggtccatggcgacttgcacctgggc
caggtactggtggtcaagggcgatgcctacctgatcgactttgaaggcgagcccgcgcgg
ccgttggaagaacggcggggcaagcacagcccctataaagatgtcagcggcgtgctgcgt
tcgttcgactatgccgccgccatggccctgaatgtgcaagggcaaggcctggatcactcg
gccgacgccgacgctgcgcgccagcgtgtgacagatcgctacctggctgaagcgcggcag
gcatttatccaggcgtatcaacaggctacgtctacactggcgcatgactggcaggatgcc
aaaggggcggatgcggcactggcgttgttcagcctggagaaggcggcgtatgaagtggcc
tacgaggcgcagaaccgcccggcctggctggcagtgccattgcgcgggctgcacggtctg
ttgtag

DBGET integrated database retrieval system