KEGG   Pseudomonas fluorescens UK4: HZ99_06890Help
Entry
HZ99_06890        CDS       T03319                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pfn  Pseudomonas fluorescens UK4
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HZ99_06890
Enzymes [BR:pfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     HZ99_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAM72
Motif
Other DBs
NCBI-ProteinID: AIG01901
UniProt: A0A379IFX3
LinkDB All DBs
Position
complement(1590650..1591729)
Genome map
AA seq 359 aa AA seqDB search
MDKHTHMQAVVCHGPKDYRLERIGKPLARPNELVIRIAACGICASDCKCHSGAAMFWGGD
NPWVKAPVVPGHEFFGYVEQVGAGAEEHFEVKVGDKVIAEQIVPCGKCRFCKSGKYWMCE
VHNIFGFQREVAEGGMAQYMRIPKTAIVHKIPESVSLEDSALIEPMACAIHTVNRGDLQL
DDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLELAKKYGADVVINPSRDNARAI
INGLTDHYGCDVYIETTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSADWSIIGDRKELD
VRGAHLGPYCYPVAIDLFERGLVTSKGIVTHDFPLDDWAEAFDLANSVKSIKVLLKPGQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggataagcacacccacatgcaagccgtcgtctgccacggcccgaaagactaccgcctg
gagcgcatcggcaaacccctggcgcggcccaacgaactggtgatccgcattgcggcctgc
gggatctgcgccagtgactgcaaatgccactctggggcggcgatgttctggggcggcgac
aacccatgggtcaaggcaccggtggtgccggggcatgagtttttcggttacgtggagcaa
gtcggcgcgggcgccgaggagcacttcgaggtcaaggtcggtgacaaggtgatcgccgag
cagatcgtgccttgcggcaagtgccgtttctgcaagtccggcaagtactggatgtgcgag
gtgcacaacatcttcggtttccagcgtgaagtggccgaaggcggcatggcccagtacatg
cgcatccccaagaccgccatcgtgcacaagattcccgagtcggtgtccctggaagattcg
gcgttgatcgagccgatggcctgcgcgatccatacggtcaaccgtggcgacctgcaactc
gatgacgtggtggtgatcgccggtgccggtaccctgggcctgtgcatggtccaggtggcc
gcgctgaaaaccccgaaaaaactggtggtgatcgacatggtcgacgagcgcctggagctg
gcgaaaaaatacggcgccgatgtcgtgatcaacccctcccgggacaacgcccgcgccatc
atcaatggcctgaccgaccactacggctgcgacgtgtatatcgagaccacgggtgtaccc
gccggtgtgacccaggggctggatctgatccgcaagctggggcgctttgtcgagttcagc
gtgttcggtgccgagaccagcgctgactggtcgatcatcggcgaccgcaaggagctggat
gtacgcggcgctcacctggggccgtattgctacccggtggccatcgacctgttcgagcgc
ggcctggtgacgtccaagggcatcgtcacccatgacttccccctggatgactgggccgaa
gcgttcgacctggccaactcggtgaagtcgatcaaggtgctgctcaagccggggcaatga

DBGET integrated database retrieval system