KEGG   Pseudomonas fluorescens UK4: HZ99_12100Help
Entry
HZ99_12100        CDS       T03319                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00473  D-Alanine metabolism
pfn00550  Peptidoglycan biosynthesis
pfn01100  Metabolic pathways
pfn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HZ99_12100
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HZ99_12100
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HZ99_12100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfn01011]
    HZ99_12100
Enzymes [BR:pfn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HZ99_12100
Peptidoglycan biosynthesis and degradation proteins [BR:pfn01011]
 Precursor biosynthesis
  Amino acid ligase
   HZ99_12100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 TTL ATPgrasp_YheCD ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: AIG02869
UniProt: A0A379IIM8
LinkDB All DBs
Position
complement(2690879..2691862)
Genome map
AA seq 327 aa AA seqDB search
MTTQYGSLFSTIAPADFGRVAVLFGGKSAEREVSLKSGNAVLQALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDAT
KEQELMDLTAKACEALGIAGWARADVMQDEQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASYVAGNAAGNEEARG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcaatacggctccctgttctccaccatcgcgcctgctgacttcggccgcgtg
gccgtgctgttcggtggcaagagtgctgagcgcgaagtgtcgctcaagtctggcaatgcc
gtacttcaagcgctgcaaagcgctggtgtgaacgcattcggcatcgacgtgggcgacgac
ttcctcgcccgcctgcaggccgagaaaatcgaccgtgccttcatcatcctgcacggccgt
ggcggtgaagacggcagcatgcagggcctgctggagtgcgccggcattccctacaccggt
agtggcatcctcgcctcggccctggccatggacaagttgcgcaccaagcaggtgtggcac
agcctgggaattccgacgccacgtcatagcgttctgtgcagtgaagacgattgtatttct
gcggccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggctaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgactcgcaagtgctggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccacccatcgcattgggcaccccccacactttttacgactac
gacgccaagtacctggcttccgatacccagtaccggatcccatgcggcctcgatgcaacc
aaagagcaggaattgatggacctcacggcgaaagcctgtgaggcgttgggtatcgccggt
tgggcgcgggcagacgtgatgcaggacgagcaggggaatttctggttccttgaagtcaac
actgcaccgggcatgaccgaccacagcctggtccccatggctgcacgtgcagccggcctg
gatttccagcagttggtgctggcgattctggcggccagctatgtggccggtaatgccgcc
ggtaatgaagaggcacgaggttaa

DBGET integrated database retrieval system