KEGG   Pseudomonas fluorescens UK4: HZ99_19335Help
Entry
HZ99_19335        CDS       T03319                                 

Definition
(GenBank) cystine transporter subunit
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HZ99_19335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfn02000]
    HZ99_19335
   02035 Bacterial motility proteins [BR:pfn02035]
    HZ99_19335
Transporters [BR:pfn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    HZ99_19335
Bacterial motility proteins [BR:pfn02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    HZ99_19335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AIG04228
UniProt: A0A379I5R2
LinkDB All DBs
Position
complement(4227418..4228212)
Genome map
AA seq 264 aa AA seqDB search
MTISVLRRTLLVGTLGLALGAGLLGQAVAGEQLGNIKKAGVIKIGLEGTYPPFSFVDESG
KLSGFEVELSEALAKELGVKVKLQATPWDGILAALESKRLDAVVNQVTISEERKKKYDFS
KPYTVSGIQALVLAKNVDTIKTADDLAGKKIGVGLGTNYEQWLKDNQPKAIIKTYNDDPT
KFQDLRIGRIDATLIDRLAALEYAKKAPDTAAAGAAFSRQESGIALRKGELELLEAVNQA
LDKLRADGTLKTLSEKYFNADVTQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactatttctgtactgcgtcgcacgttgctggttggcacattgggcctggcccttggc
gccgggttgctgggccaggcggttgccggcgagcaactgggcaacatcaagaaggccggc
gtgatcaagatcggcctggaaggcacctacccgccgttcagcttcgtcgatgaaagcggc
aagctcagcggttttgaagtcgagctgtccgaagccctggccaaggagctgggcgtcaag
gtcaagctgcaagccaccccgtgggacggtatcctcgccgcgctggagtccaagcgcctg
gacgccgtggtcaaccaagtgacaatctccgaagagcgcaagaaaaagtacgatttctcc
aagccctataccgtctccggtatccaggcgctggtcctggcgaaaaacgtcgacaccatc
aagaccgccgatgacctggccggcaagaaaatcggcgtaggcctgggtaccaactacgaa
caatggctcaaggacaaccaacccaaagccatcatcaagacctataacgacgaccccacc
aagttccaggacctgcgcatcggccgtatcgacgcgactctgatcgaccgcctggcggcc
ctggaatatgcgaaaaaagccccggacactgccgctgccggcgcggccttctcccgccag
gaatccgggattgccctgcgcaaaggcgagcttgagctgctcgaagcggtcaaccaggcc
ctcgacaaactgcgcgccgacggcaccttgaagacgctgtccgaaaaatacttcaacgct
gacgtcactcaataa

DBGET integrated database retrieval system