KEGG   Pseudomonas fluorescens UK4: HZ99_22400Help
Entry
HZ99_22400        CDS       T03319                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HZ99_22400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pfn01003]
    HZ99_22400
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfn01011]
    HZ99_22400
Enzymes [BR:pfn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HZ99_22400
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HZ99_22400
Glycosyltransferases [BR:pfn01003]
 Polysaccharide
  Bacterial polysaccharide
   HZ99_22400
Peptidoglycan biosynthesis and degradation proteins [BR:pfn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HZ99_22400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AIG04795
UniProt: A0A379I8F1
LinkDB All DBs
Position
4906082..4908403
Genome map
AA seq 773 aa AA seqDB search
MTRTRSPRTRKKPPSRSLRPWLGWALKLGLVGLVVIAGIAVYLDAVVQEKFSGKRWTIPA
KVYARPLELFTGQKLSKADFLTELDALGYRREAVANGPGAAAVSGNTVDLNTRGFQFYEG
LEKAQPVRVRFSGDYVAELSALNGGKLPVVRLEPLLIGGIYPKNLEDRILIKIDQVPPYL
LETLVAVEDRDFYSHWGVSPKSIARAIWVNTSGGRMTQGGSTLTQQLVKNFYLTSERSLT
RKLTEAMMAMLLELHYSKQEILEAYLNEVFVGQDGQRAVHGFGLASQFFFGQPLSELKLH
QVALLVGMVKGPSYYNPRRNPERALERRNLVLDVLEQQGVATAEQVAAAKKMPLGVTTRG
KLADSSFPGFIDLVKRQLREDYRDEDLTEEGLRIFTSFDPILQMKAEASVSDTFKRLAGR
KGSDEVEAAMVVTNPETGEVQAMIGSRQASFAGFNRALDAVRPIGSLIKPAVYLTALEKP
SKYTLTSWLSDEAFSVKGADGQVWKPQNYDRRSHGTVFLYQGLAHSYNLSTARLGLELGV
PNVLKTLARLGVSREFPAFPSMLLGAGGLSPMEVATMYQTLANGGFNTPMRGIRSVLTAE
GEPLKRYPFQIEQRFDPASIYLIQNAMQRVMREGTGRSVYSVLPSNLTLAGKTGTSNDSR
DSWFAGFSQDLLAVVWLGRDDNGKTPFTGATGALQVWTSFMRKADPLPLNMPQPDNIVQA
WIDPHTGQGSDANCPGAVQMPYIRGSEPPAGAACGGLPTDADSVMDWVKGWMN
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtacccgatctccccgtacccgtaaaaaacctccttctcgcagcctgcgcccc
tggctgggctgggcgctcaagcttggcctggttggcctggtggtgatcgccggcatcgcg
gtatacctcgatgccgtggtccaggagaaattctctggcaagcgctggaccatcccggcg
aaggtctacgctcgcccgctggagctctttaccggccaaaagctgagcaaggctgacttc
ctcaccgaactcgatgcgctgggttaccggcgcgaagccgtggccaacgggccaggggcg
gcggcggtcagtggcaataccgtggacttgaacacccggggtttccaattctatgaaggc
ctggaaaaggcgcagccggtgcgcgtgcgtttctcgggggactacgtggctgagctttcc
gcactcaacggcggcaagctgccggtggtgcgtcttgagccgttgctgatcggcgggatt
tacccgaagaacctcgaagatcgcatcctgatcaagatcgatcaggttccaccgtacctg
ctggaaaccctggttgcggtcgaagaccgggatttttacagccactggggcgtatcgccc
aagtccatcgcccgcgccatctgggtcaacacctccggtggccggatgacccagggcggc
agtacgctgacgcaacaattggtgaaaaacttctacctgaccagtgaacgcagcctgacc
cgcaaactcaccgaagccatgatggcgatgttgctggaactgcactacagcaagcaggag
attctggaggcctacctcaacgaggtgttcgtcggccaggatggccagcgcgcggtgcac
ggtttcggcctggccagccagttctttttcggccagccgttgtccgagctcaagctgcat
caggtggcgttgctggtgggcatggtcaagggaccgtcctattacaaccctcgccgtaac
ccggagcgggccctggagcgtcgcaacctggtactcgacgtcctcgagcagcagggcgta
gccacggctgaacaggtcgccgccgcgaagaagatgcccttgggcgtcactacccgtggc
aagttggccgacagttcattcccaggctttatcgatctggtcaagcgccagttgcgcgaa
gactatcgcgatgaggacttgaccgaagaaggcctgcggatcttcaccagtttcgacccg
atcctgcagatgaaggccgaagcctcggtcagcgataccttcaaacgcttggctgggcgc
aagggctcggacgaggtcgaggcggccatggtcgtgaccaatccggaaaccggtgaagtc
caggccatgatcggcagtcgtcaggccagtttcgccggtttcaatcgtgcactggatgcc
gtgcggccgattggctcgctgatcaagccggcggtgtacctcactgcgctggaaaagccg
agcaaatacaccctgaccagttggctctccgacgaagcattctcggtcaagggcgccgat
ggccaggtgtggaagccgcagaactatgatcgtcgctcccacggcactgtgttcctgtat
cagggcctggcgcattcctacaacctgtccacggcgcggcttggtctggagctgggtgtg
ccgaatgtgctcaagacgctggcgcgattgggcgtgagccgcgagttcccggccttcccg
tcgatgttgctgggtgcggggggcttgagcccgatggaagtggcaaccatgtaccagacc
ctggccaatggcggtttcaatacgccgatgcgcgggatccgcagtgtcttgacggcggaa
ggggaaccgctcaagcgctacccattccagatcgagcagcgttttgatccggcctctatt
tacctgatccagaacgccatgcagcgagtcatgcgcgaaggtacggggcggtcggtctac
agcgtgctgccgtccaacctgacgctggccggcaagaccggtaccagtaacgattcccgt
gacagctggttcgccggcttcagccaggacctgctcgcggtggtctggctggggcgcgat
gacaacggcaagacaccgtttaccggcgcgaccggcgccttgcaggtctggaccagcttt
atgcgcaaggcggacccgctgccattgaacatgccgcaacccgacaatatcgttcaggcc
tggatcgacccccataccggccagggctccgatgccaactgtccgggtgcggtgcagatg
ccgtatattcgcggcagtgaaccgccagccggcgctgcgtgtgggggcttgcccacagac
gcggattcggtgatggattgggtcaagggctggatgaattaa

DBGET integrated database retrieval system