KEGG   Pseudomonas fluorescens UK4: HZ99_23995Help
Entry
HZ99_23995        CDS       T03319                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn00620  Pyruvate metabolism
pfn00680  Methane metabolism
pfn01100  Metabolic pathways
pfn01120  Microbial metabolism in diverse environments
pfn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HZ99_23995
  09102 Energy metabolism
   00680 Methane metabolism
    HZ99_23995
Enzymes [BR:pfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HZ99_23995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HAMP
Motif
Other DBs
NCBI-ProteinID: AIG05085
UniProt: A0A075PDY8
LinkDB All DBs
Position
5241249..5243894
Genome map
AA seq 881 aa AA seqDB search
MSDIDARLREDVHLLGELLGNTIREQYGDEFLDKIEQIRKGAKADRRGAATEAVAGEELS
ASLNQLQEDELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFESRVLPELLARLQSE
GHSSESLARQLARLEIELVLTAHPTEVARRTLIQKYDAIAAQLALQDHRDLTGAEREQIR
QRLQRLIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPNYLRKADQALHAATGLR
LPLEAAPIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDIDHLASELSMQRA
SPELQARAGDSVEPYRALLKQLRERLRATRNWAHAALASNVPAPAEVLQNNRDLLEPLEL
CYQSLHACGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHSAAMTEITDYLGLGRY
EDWDEDARITFLMKELANRRPLLPGYFKPSADTAEVLNTCKEIAAAPAASLGSYVISMAG
AASDVLAVQLLLKESGVQRPMRVVPLFETLADLDNAGPVIERLLLLPGYRARLQGPQEVM
IGYSDSAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILS
QPPGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPAWRHLMD
ELAADGVSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIF
GWTQTRLMLPAWLGWEAALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIA
RLYDERLVQPDLLPLGAHLRDLLSQACAVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPL
HLLQAELLARSRQQEAAQDSPLEQALLVSVAGIAAGLRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatcgatgcacgtttgcgtgaagatgttcacctgctgggtgaactgctgggc
aacacgattcgagagcagtacggtgatgagttcctcgacaagatcgagcagatccgtaaa
ggcgccaaggccgatcgccgtggtgcggccacggaggcagtggccggcgaagagctcagt
gccagtctcaaccagttgcaggaagacgaattgctaccggtggcgcgtgcgttcaaccag
ttcctcaacctggccaacatcgccgaacagtaccaactgattcaccggcgcgatgagtcc
cagccagccccgttcgagtcacgggtgctgcccgaactgttggcgcgcctgcagagtgag
ggccatagcagcgagtccctggcccggcagttggcgcggctggagatcgaactggtgctc
accgcccacccgaccgaagtcgcgcgccggaccctgatccagaaatacgatgccatcgcc
gcgcaactggcgttgcaggatcaccgcgacttgaccggcgccgagcgcgagcagattcgc
caacgcttgcaacgcctgatcgccgaagcctggcacaccgaagaaatccgccgtacccgg
cccactccggtggacgaggccaagtggggctttgcggtgatcgagcattcgctgtggcac
gccatccccaactacctgcgcaaggctgaccaagccttgcacgccgccaccggcctgcgc
ctgcccctggaggctgcaccgattcgctttgcctcatggatgggcggcgaccgtgatggc
aatcccaatgtgaccgctccggttacccgtgaagtgctgttgctggcgcggtggatggcg
gcagatctgtacttgcgtgatatcgatcacctggcatcggagctgtcgatgcagcgggcc
agccccgagttgcaagccagggccggtgatagcgtcgagccttatcgggccctgctcaag
caactgcgcgaacgcctgcgcgccacccgcaattgggcgcatgcggcgctggctagcaac
gttccggcgccggccgaggtgctgcaaaacaatcgcgatctgctggagcccctggagctg
tgctatcagtccctgcacgcctgcggcatgggggtgatagccgacggcccgctgctcgat
tgcctgcgccgtgcggtaacgtttggcctgttcctggtacgcctggacgtgcgccaggac
tccagccggcattcggcggcgatgaccgagatcaccgactacctcggcctgggccgctat
gaggactgggacgaagacgcacgcatcaccttcctgatgaaggagttggctaaccgtcgc
ccattgttgccaggctatttcaagccgtcggccgacaccgccgaagtgctcaatacctgc
aaggaaattgccgccgcgccggcggcgtcccttggttcctatgtcatctccatggcgggt
gcggcatccgatgtgctggcggtacagttgctgctcaaggagtccggggtgcagcggccg
atgcgcgtggtgccgctgttcgagaccctggccgacctggacaacgccggcccggtgatc
gagcgcctgttgctgctacctggctatcgcgcgcgcttgcaaggcccgcaggaagtgatg
atcggctactcggactcggccaaggacgccggcaccaccgccgcggcctgggcgcaatac
cgcgctcaggagcgcctggtggatatctgccgtgagcagcaggtggaactgttgttgttc
catggtcgtggcggcactgttggccgtggcggcggcccggcccacgcggcgattctgtcg
cagccgccaggttcggtggccgggcgtttccgcaccaccgagcagggcgagatgattcgc
ttcaagttcggcttgccggatatcgccgagcagaacctcaacctgtacctggccgcggtg
ctggaggcgaccttgttgccaccgccaccaccggaaccggcctggcgtcatttgatggat
gagttggccgccgatggtgtcagcgcctatcgcgcggtggtgcgggaaaatccgcaattc
gtcgagtacttccgccagtccacgcccgagcaggaactgggacgtctgcccctgggcagt
cgaccggccaagcgccgtgccggtggcattgagagtctgcgtgcgatcccgtggattttc
ggctggacccagacccgcctgatgctgccggcctggctgggttgggaagcggctttgagc
aaggcgttggagcgcggcgaaggtgagttgctggggcagatgcgtgaacaatggccgttt
ttccgcactcgtatcgatatgctggaaatggtcctggccaaggccgacgctgatatcgcc
cgcctgtatgacgagcgtctggtgcagcccgacctgctgccgttgggtgcgcatttacgc
gacctattgtcgcaggcgtgtgccgtggtgcttggcctgaccgggcagtcgcagctgctg
gcccacagtcccgacaccctggagttcatccgcctgcgcaacacctacctcgacccgttg
cacctgttgcaggccgagctgctggcccgctcgcgccagcaggaagcggcacaggacagc
cctctggaacaggcgctgctggtgtccgtggccggtattgccgccggattgcgcaacacc
ggctga

DBGET integrated database retrieval system