KEGG   Pseudomonas fluorescens UK4: HZ99_24920Help
Entry
HZ99_24920        CDS       T03319                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
pfn  Pseudomonas fluorescens UK4
Pathway
pfn03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pfn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    HZ99_24920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pfn03400]
    HZ99_24920
Enzymes [BR:pfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     HZ99_24920
DNA repair and recombination proteins [BR:pfn03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     HZ99_24920
 Prokaryotic type
     HZ99_24920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG AAA_29
Motif
Other DBs
NCBI-ProteinID: AIG05266
UniProt: A0A379I9R3
LinkDB All DBs
Position
5438595..5439287
Genome map
AA seq 230 aa AA seqDB search
MTSDDRIKLEPSWKHALREEFEQPYMTELREFLRQEHAAGKEIYPPGPLIFNALNSTPLD
KVKVVILGQDPYHGPGQAHGLCFSVQPGVPTPPSLVNIYKELKRDLNIDIPSHGCLQSWA
DQGVLLLNTTMTVERANANAHAGKGWQFFTDRIIEVVSQHQPHLVFLLWGAHAQGKQKLI
DATKHLVLTSVHPSPLSAYRGFLGCGHFSRTNKFLEQNGEMPIEWRLPPI
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgacgaccgtatcaaactcgaaccgagctggaaacacgccctgcgcgaggag
ttcgagcagccgtacatgactgaactgcgcgagttcctgcgccaggagcatgcggcgggc
aaggaaatctacccgccggggccgctgatcttcaatgcgctcaactccacgccgctggac
aaggtcaaggtggtgatcctcggccaggacccgtaccacggcccgggccaggcccatggc
ctgtgcttctcggtgcaaccgggcgtgccgacaccgccgtcgctggtcaatatctataaa
gaactcaagcgcgacctcaacatcgacatccccagccacggctgcctgcaaagctgggcc
gaccagggcgtgttgctgctcaacaccaccatgaccgtggagcgtgcgaatgccaatgct
catgcgggcaagggctggcagttctttaccgataggattatcgaggtggtcagccagcac
caaccgcacctggtgttcctgctgtggggcgcccatgcccagggcaagcagaagctgatc
gatgcgaccaaacatttggtactgacttcggtgcacccgtcgccgttgtcggcgtatcgc
gggttcttgggctgcgggcatttcagccgcaccaacaagtttcttgagcaaaatggcgag
atgccgatcgagtggcggttaccgccgatctaa

DBGET integrated database retrieval system