KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_1112Help
Entry
Pfl01_1112        CDS       T00283                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00061  Fatty acid biosynthesis
pfo00780  Biotin metabolism
pfo01100  Metabolic pathways
pfo01212  Fatty acid metabolism
Module
pfo_M00083  Fatty acid biosynthesis, elongation
pfo_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pfl01_1112
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pfl01_1112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pfo01004]
    Pfl01_1112
Enzymes [BR:pfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Pfl01_1112
Lipid biosynthesis proteins [BR:pfo01004]
 Fatty acid synthase
  Component type
   Pfl01_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ABA72855
UniProt: Q3KHA1
LinkDB All DBs
Position
1286708..1287148
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVELDTEGKRIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLILEAKFISCKRQI
WKFECQASVDGKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgttacccgttcctgctggtg
gatcgggtagtggagctggatacggaaggcaagcgcattcgcgcctacaagaatgtcagc
atcaacgagccgttcttcaacggtcacttcccggcgcacccgatcatgccgggcgtgctg
atcatcgaagccatggctcaggctgccgggatcctcggtttcaagatgcttgacgtgaaa
ccggccgacggcaccctttattacttcgttggctccgacaaactgcgtttccgccagcca
gtgctgccgggcgatcagttgatcctcgaagccaagttcatcagttgcaagcgtcagatc
tggaagttcgaatgccaggcttcggtcgatggcaaaccggtctgctcggctgaaatcatc
tgtgcggaacgcaagctatga

DBGET integrated database retrieval system