KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2097Help
Entry
Pfl01_2097        CDS       T00283                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Pfl01_2097
Enzymes [BR:pfo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pfl01_2097
DNA repair and recombination proteins [BR:pfo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Pfl01_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ABA73840
UniProt: Q3KEG6
LinkDB All DBs
Position
2382341..2384887
Genome map
AA seq 848 aa AA seqDB search
MSRNLDDYNRMRDFSATSEPAAGHRRGKKPAGDHALQFCIQKHDASHLHYDFRLELDGAL
KSWAVPKGPSLDPKVKRLAVHVEDHPLDYATFEGSIPEGHYGAGDVIVWDRGVWIPLEDP
EKAYAKGKLKFELQGEKLAGVWNLVRTHMPGKKEQWFLIKHQDGAARPQSDYDVLVAEPD
SVLSERTIVDKPRLSAKQVKPLQGPAKAPRKSASGKLTGAHKAKIPAQLKPQLATLVESA
PEGDWQYEIKFDGYRIMARIDQDEVQLFTRNGHDWTHKLPKQAQALAALGLESAWLDGEM
VVADADGVPDFQALQNAFDSGRSENIVYYLFDLPYLNGVDLREVAVEERRAALATVLKTH
QDPLLRFSEAFDETPQALLNSACQMRMEGLIGKRLGSPYVSRRSSDWIKLKCKHRQEFVI
VGYTDPKGARSSFGALLLGLHDRDSGELRYAGKVGTGFNETTLKSILAQLKPLRVKKPAV
ANPPTGFEAKGVHWLKPSLLAEVAFAEMTQDGSVRHAVFHGLREDKPAKDITEERAKPMN
TSKTESTAPSQSGLADGKVRITHPDRVIDASSGTTKMQLAEYYASVAEWILPQLKDRPVA
LVRAPDGIAGDLFFQKNAEHLAIPGIRTLDKELTGQPVMLINNAEALIGAVQMSTVELHT
WNATTTDLDKPDRFVLDLDPDPALPWKSMIEATALTLTVLDELGLKAFLKTSGGKGIHLV
VPLTRKHGWDEVKDFSHAIVTHMAKLLPERFSAVSGPKNRVGRIFIDYLRNGLGATTICA
YAARTREGLPVSVPLFREEVGEIKGADQWNVHNVHERLAEVGDEPWADIKKTRQSITAEM
RKRVGMKK
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggaatctcgacgactacaaccggatgcgcgacttttcagcgacctctgaaccg
gcggctggccaccgccggggcaagaaacccgccggcgaccacgccctgcagttctgcata
caaaagcacgatgcctcgcatctgcattacgactttcgcctcgagctcgacggcgcgctc
aagagctgggcggtgcccaaggggccgtcgctggatcccaaggtcaagcggctggcggtg
cacgttgaggatcatccgctggactacgcgacgttcgagggcagcattcccgaggggcat
tacggcgccggcgatgtgatcgtctgggatcgtggcgtgtggattccgttggaagacccg
gagaaagcctacgccaagggcaagctcaaattcgaactgcaaggcgagaagctcgccggg
gtgtggaacctggtgcgcacccacatgccgggcaagaaagagcagtggtttctgatcaag
catcaggacggcgccgcacgcccgcaaagcgattacgacgtgctggtcgccgagcccgac
agtgtgctcagcgagcgcacgatcgtcgacaaaccccggcttagtgcgaagcaggtcaaa
ccccttcaaggcccggcgaaagcaccccgcaagtcggcctcgggcaagctcaccggggcg
cacaaggccaaaattcccgcgcagctcaaacctcaactcgccaccttggtggagagcgcg
ccggagggcgattggcaatacgaaatcaagttcgacggttatcggatcatggcgcgcatt
gatcaggacgaggtgcagttgttcacccgcaatggccatgactggacgcacaagttgcca
aagcaggcgcaagccctggcggcgctgggcctggagtcggcgtggctggatggtgagatg
gtcgtcgccgatgcggacggcgtgcctgattttcaggccctgcaaaacgcgttcgattcg
ggacgcagcgaaaacatcgtctattacctgtttgatctgccgtatctgaacggtgtcgac
ctgcgcgaggtggcggtggaggaacggcgcgcagcgctggccaccgttctgaaaacccat
caagacccgctgctgcgtttctccgaagcgttcgacgaaaccccgcaggcgttgctcaac
agcgcctgtcagatgcgcatggaaggcctgatcggcaaacgcctcggctcgccttacgtg
tcgcgccgcagcagcgactggatcaagctcaagtgcaagcatcgccaggaattcgtgatc
gtcggctacaccgatccgaaaggcgcgcgcagttcgttcggcgcactgttgctgggtctg
catgatcgtgacagcggcgagttgcggtacgccggcaaggtcggcacgggattcaatgaa
accaccctcaagagcatcctcgcgcagctcaaaccgttgcgagtgaaaaaaccggcagtg
gccaacccgcccacagggttcgaggccaagggtgtgcactggctcaaaccgagtctgctg
gcggaagtggcgttcgccgaaatgacccaggatggctcggtgcgccatgccgtgttccat
ggcttgcgcgaggacaaaccggccaaggacatcaccgaggagcgcgccaaacccatgaac
acttcaaagactgaatctaccgccccgtcccaatccgggctggccgacggcaaggtgcgg
atcactcatcccgaccgggtgatcgatgccagcagtggcaccaccaaaatgcagctggcc
gagtattacgccagcgtcgccgaatggattctgccgcagctcaaggatcgcccggtggcg
ctggtgcgcgcgccggacggcattgccggtgatctgtttttccagaagaacgccgaacac
ctggcgatccccggcatccgcacactcgacaaggagctgaccggccagccggtgatgctg
atcaacaatgccgaagccttgatcggcgcggtgcagatgagcacggtcgaactgcacacc
tggaacgccaccacgacggatctggacaagcccgaccgctttgtcctcgacctcgacccg
gacccggcgctgccctggaaaagcatgatcgaagccacggcactcaccctgaccgtgctg
gatgaactgggcctcaaggcgtttctcaagaccagcggtggcaagggcattcatctggtg
gtgccgctgacccgcaagcatggctgggacgaggtcaaggatttcagccacgccatcgtc
acgcacatggcgaaattgttgccggagcgtttttctgcggtgtccgggccgaaaaaccgt
gtggggcggatcttcatcgattacctgcgcaacgggctgggcgccaccaccatttgcgcc
tacgcagcgcgtacccgcgaaggattaccggtgtcggtgccgctgtttcgggaagaagtc
ggcgagatcaaaggcgccgatcaatggaacgtacacaacgttcacgaacggctcgcggaa
gtaggcgatgaaccttgggcggacatcaagaaaacccggcaaagcatcacggccgagatg
cgcaagcgggtgggcatgaagaaatga

DBGET integrated database retrieval system