KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2535Help
Entry
Pfl01_2535        CDS       T00283                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00500  Starch and sucrose metabolism
pfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pfl01_2535
Enzymes [BR:pfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Pfl01_2535
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Pfl01_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF2333
Motif
Other DBs
NCBI-ProteinID: ABA74276
UniProt: Q3KD79
LinkDB All DBs
Position
2898035..2901376
Genome map
AA seq 1113 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDTDAEGVNGDECHMAFHFPLMPRMYMALAQEDR
FPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRR
RLAPLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRN
GGFSRADPASLVLPPIMDPQYGYQSVNVETQAGDPHSLLNWTRRLLAVRKQSKAFGRGTL
KMLSPANRRVLAYTREYTGPDGKHEIILCVANVSRSAQAVELDLSAYVGMVPVEMLGGNA
FPPIGQLSFLLTLPPYGFYWFGLAAENQMPSWHVEPAQSLPDFTTLVLKKRMEELLEAPS
RATLEQAILPSWLQNRRWFAGKDADIEQVKLAYGVRFGDAQHPVLFSEIEVQSGGQTSRY
QLPFGFISEDQVGPALPQQLALARVRRVRQVGLITDAFSLEAFIRAVLQGMQGGTVLESI
EGEIRFEATPQLEKLGLGAESEVRYLSAEQSNSSVVIGNSLVLKLIRKVASGVHPELEMS
AYLTAAGFANISPLLGSVIRRDGKGEDNLLMIAQGYLSNQGDAWEWTQNNLERALRDELA
DAVSEQAQHYNALGELKDFAGMLGQRLGEMHQVLAAPSDNQDFAPQVSSAKDAQATGKDV
AAQVEHALKLLKQHQGELDAADQKLVGRLLDHKKAILAHVQELAKQSAGGLRIRVHGDLH
LGQVLVIKGDAYLIDFEGEPARPLAERRGKHSPYKDVSGVLRSFDYAAAMALNVHNVDNS
PEAEAARRRVTERYLREAREAFLQAYRQAAASLDHAWQDPEGADAALALFGLEKAAYEVA
YEAENRPTWLPVPLHGLYGLLTGLKPFSDLGGE
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggcagccaccttcatcaaggacccgctctggtacaaggacgcg
gtcatctatcaagttcacgtcaaatcctttttcgattcgaataacgacggaatcggcgac
tttcccggcctgatcgccaaactcgattacatagccgatcttggcgtcaacaccatctgg
ctgttgccgttctacccctcgccacgccgcgacgacggttacgacatcgccgagtaccga
ggcgtgcacagcgattacggaacgatggccgacgccaagcgtttcattgccgaggcgcat
aaacgcgggttgagggtcatcaccgagctggtcatcaaccacacgtccgatcagcacccg
tggtttcagcgcgcgcgcaaggccaagcccggttcggccgcgcgggacttctatgtgtgg
tcggatgacgaccagaaatacgacggcacccggatcatttttctcgacaccgaaaagtcc
aactggacctgggatccggtggccggtcagtacttctggcaccgcttctattcgcaccag
ccggatctcaacttcgataacccgcaagtcatgaaagccgtgctgtcggtcatgcgctac
tggctggacatgggcatcgacggcctgcgactggatgcgattccgtacctgatcgaacgc
gacggcaccaacaacgaaaacctcccggaaacccacgacgtcctcaagcagatccgtgcc
gagatcgacgccaactaccccgatcgcatgctgctggccgaagccaatcaatggccggaa
gacacccagctgtacttcggcgacaccgacgccgagggcgtgaatggtgacgagtgtcac
atggcgttccacttcccgttgatgccgcgcatgtacatggcgctggcccaggaagatcgc
ttcccgatcaccgacatcctgcgtcagaccccggaaatcccggccaactgccaatgggcg
attttcctgcgcaaccacgatgagctgacgctggagatggtgaccgacaaggagcgcgac
tacctgtggaactactacgccgctgaccgtcgtgcgcggatcaaccttggcatccgccgc
cgtctggcgccgttgatggagcgtgaccgccgccgcatcgagctgctgaacagtctgctg
ttgtcgatgcccggcacgccgaccctgtattacggcgatgaaatcggcatgggcgacaac
atctacctcggcgaccgcgacggtgtacgcacgccgatgcaatggtcgatcgaccgcaac
ggcggtttctcccgcgccgatccagccagtctggtactgccgccgatcatggacccgcaa
tacggttatcaatcggtcaacgtcgaaacccaggccggtgacccgcattcgctgctgaac
tggactcgccgcctgctggcggtgcgcaagcaatccaaggcattcgggcgcggcacgctg
aaaatgctttcgccagccaaccgccgggtgctggcctacacccgtgaatacaccgggccg
gacggcaagcacgaaatcattctgtgcgtggccaacgtgtcacgcagtgctcaggcagtg
gagctcgacctgtcggcctacgttggcatggtgccggtggagatgctcggcggtaacgcc
ttcccgcccatcggccagttgagtttcctgctgaccctgccgccttacggtttttactgg
ttcggcctggcggcggaaaaccagatgccgagctggcacgtcgaaccggcgcagagcctg
ccggacttcaccacgctggtactgaaaaaacgcatggaagagctgctcgaagcgccgtcc
cgggccaccctcgagcaggcgattctgccgagctggctgcagaaccgccgctggttcgcc
ggcaaggatgctgatatcgaacaggtgaaactggcctacggcgtgcgcttcggcgatgca
cagcatccggtgctgttcagcgaaatcgaagtgcagagcggcgggcagaccagtcgttat
caattgccgttcggctttatttcggaagatcaggtcgggccggcgttgccgcaacaactg
gctttggcgcgggtacgccgggtgcgtcaggtcgggttgattaccgatgccttcagtctt
gaagcgtttattcgcgctgtgctgcaaggcatgcagggcggcacggtgctcgaatccatt
gagggcgagatccgtttcgaggcaacgccgcaactggaaaaacttggcctgggcgcagag
tccgaagtgcgctatctgtccgccgagcaatccaacagttcggtggtgatcggcaacagt
ctggtgctcaagctgatccgcaaagtcgcttctggcgtacacccggaactggagatgagc
gcttacctgaccgctgctggatttgccaatatctctccgctgctgggctcggtgattcgc
cgcgacgggaagggcgaggacaacttgctgatgattgcgcagggctatctgagcaatcag
ggcgacgcctgggaatggacgcagaacaacctcgaacgggcgctgcgcgacgagctggcc
gacgccgtgtccgagcaggcgcagcactacaacgccttgggtgaactgaaggatttcgcc
gggatgctcggccagcgtctgggggaaatgcatcaggtgctggcagcgccgagcgacaac
caggacttcgcgccgcaagtcagttcggccaaggatgcgcaggcgacgggtaaggatgtc
gcggcgcaggtcgagcatgccctgaagctgctcaaacagcatcagggcgagctcgatgcg
gcggatcagaagctggtcggtcggctactcgaccacaagaaagccatccttgcccacgtg
caggaactggccaagcaatccgccggcggtctacggattcgtgtgcacggcgacctgcat
ttgggacaggtgctggtaatcaagggcgatgcctacctgatcgacttcgagggcgaaccg
gcgcggccactggccgagcgccgtggcaagcacagtccgtacaaggacgtcagcggagtg
ctgcgctccttcgactatgccgccgcgatggcgctgaatgtacacaacgtcgacaacagc
cccgaggccgaagccgcgcgtcggcgggtcacggagcgttacctgcgtgaagcccgggaa
gcatttctccaggcatatcgccaagcggcagctagtcttgatcatgcctggcaagatcct
gaaggtgccgacgccgcactggcgttgttcggtctggagaaagcggcctacgaagtggcc
tatgaagccgaaaatcgccccacctggctgcccgtgccgctgcacggtctgtatgggtta
ttgacggggctcaaacccttttccgatcttggtggagagtag

DBGET integrated database retrieval system