KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_2924Help
Entry
Pfl01_2924        CDS       T00283                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Brite
KEGG Orthology (KO) [BR:pfo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pfl01_2924
Enzymes [BR:pfo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pfl01_2924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C Glutaredoxin NAD_binding_8 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABA74665
UniProt: Q3KC40
LinkDB All DBs
Position
complement(3369161..3370723)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSREMLDLLKDIASLSHQITLIDSGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRKIMAVPSIYLNGENF
GQGRMGLEEILAKLDTGAIERQAEKISAKQAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRADKLIPGKNGEL
HEVRFASGATLKAKSVILATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSALTTEVTGDGQ
KVNGLRYKDRNTDELRTVELEGIFVQIGLLPNTDWLKGTIELSPRGEIIVDNRGETSIPG
IFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcgtacctggaacgggtcacccagccg
atcgagatcgttgcttcactcgacgacggtgcgaaatcccgtgaaatgctcgacctgctg
aaagacattgccagtctttcgcatcagattaccttgatcgacagcggcgacgatgcacgc
aaaccgtcgttctcgatcaaccgccccggggccgatatcagcctgcgtttcgccggcatc
ccgatgggccatgaattcacttcgctggtgctggccctgctgcaagtcggcggccaccct
tcgaaggccagtgtcgaagtgatcgaacagatccgctcgctcaagggcgagttcaacttc
gagacgtacttctcgctgtcctgccagaactgcccggacgttgttcaggcattgaacctg
atggccgtgctgaacccgaatatccgccacgtcgccatcgacggcgcgctgttccaggac
gaagtcaacgatcgcaagatcatggctgtgccgagcatttacctgaacggcgaaaacttc
ggccagggccgtatgggcctggaagaaatcctcgccaaactcgacactggcgccatcgag
cgtcaggcggagaaaatcagcgccaagcaagccttcgatgtgctggtggttggcggtggc
ccggccggtgcttcggcggcgatctatgccgcacgtaaaggcattcgcaccggtgtggcg
gccgagcgcttcggcggtcaggtgctggacaccatggccatcgagaacttcatttccgtg
caggaaaccgaaggcccgaaactggcgaccgcgctggaagagcacgtcaagcagtacgac
gtcgacatcatgaacctgcaacgcgccgacaagctgatcccgggcaagaatggcgagctg
catgaagttcgcttcgccagcggcgcgaccctcaaggccaagagcgtgattctggccacc
ggtgcgcggtggcgtgaaatgaacgtgccgggcgaacaggaataccgtaacaaaggcgtg
gcgtactgcccgcactgcgacggcccgctgttcaaaggcaagcgtgtggcggtgattggc
ggcggtaactccggcgtcgaagcggccattgacctggccggtatcgtctcccacgtgact
ctgctggagttcgacgttcagttgcgcgccgacgccgtattgcaacgcaagctgcacagc
ctgccgaacgtcaccgtgatcaccagtgcgctgaccactgaagtcactggcgacgggcag
aaggtcaacggcctgcgctacaaggatcgcaatactgacgagctgcgcactgtcgaactg
gaagggattttcgtgcagatcggtctgctgcccaacaccgactggctcaaaggcaccatc
gagctgtcgccgcgcggcgagatcatcgtcgacaaccgcggcgaaacctcgatccccggc
atcttcgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgatcgcagtgggc
gagggtgccaaggcttccctcagtgctttcgatcacctgatccgcacgtcggctccggcg
taa

DBGET integrated database retrieval system