KEGG   Anthracocystis flocculosa: PFL1_00216Help
Entry
PFL1_00216        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00500  Starch and sucrose metabolism
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFL1_00216
Enzymes [BR:pfp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PFL1_00216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 19314350
NCBI-ProteinID: XP_007875904
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MKLTVASLLLSLSLFGTALGATTDDWKTRTIYQIITDRFAVNGTPGSCPNGSRDYCGGSF
RGIMSKLDYIQGMGFDAVWISPIVKNVEGQSYHGYWAQDINQINPHFGTADDLKALSAEL
HRRGMYLMVDVAPNHNGPQSSGAVSSDSYYSLYAPFNQKAYYHNYCTISNYNDQNNVEQC
WLGSTPSDALPDLNTENSFVTSTYYSWISNLVKSYQIDGLRVDTVKHCPRAWWPGFKSSS
GVFNIGEVFSGDPAYVKPYQDAAMDGLLNYPVYYPLQRAFQSTNRGFGEMKQMVNTIRST
YRDPLAMGTFLDNHDNPRFASTVTDKMLVRNAMTYILVGDGIPVLYYGQEQDYSGGQDPY
NREALWTSGYNTNTDSYKYIAAVNKLRKFVKNRADKPLTTQLTSLFDNSGSWAFNKGNML
VVLSSAGQNGGTQIVSIGSSSLPAGQMTNVINCATINVNSGGSVTIQLNGGQPAIFYPSS
SLGGSGICGK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaccgtcgcttcgctgctcctctcgctctccctgttcggcaccgccctcggc
gcgacaaccgatgactggaagacgcgcaccatctaccagatcatcaccgaccgcttcgcc
gtcaatggaacgcccggcagctgccccaacggcagccgcgactactgcggcggcagcttc
cgtggcatcatgagcaagcttgattacatccagggcatgggtttcgatgcagtctggatt
tcgccgatcgtcaagaacgtcgagggccaaagttaccacggctactgggcccaggatatc
aaccagatcaacccgcactttggcacggccgacgatctgaaggcgctttccgccgagctc
caccgtcgcggcatgtatctcatggtggacgtcgcgccgaaccacaacgggcctcagtcg
tccggcgccgtcagctcggactcgtactattcgctctacgctccattcaaccagaaggcc
tactatcataactattgcactattagcaactacaacgaccagaacaacgtcgagcagtgc
tggctcggcagcacgcccagcgacgcgctcccggacctcaacaccgaaaactcgtttgtg
accagcacctactacagctggatcagtaacctcgtcaagtcgtatcagatcgatggtctg
cgtgtggacacagttaagcattgtccacgggcctggtggccaggcttcaagagcagcagc
ggtgtcttcaacatcggcgaggtcttctccggcgaccccgcctatgtcaagccatatcaa
gacgcagcgatggatgggcttctgaactatcctgtctattacccccttcaacgggcgttc
cagtccactaaccgtggcttcggtgagatgaaacagatggtcaacacgatccgttcgact
taccgtgatccgctggcgatgggaacgttcctggataaccacgacaatccccgtttcgcc
tcgacggtcacggacaagatgctcgtgcgtaacgccatgacctatatcctggtcggcgac
ggtattcctgtactttactacggccaagagcaagattactcgggcggccaggacccgtac
aaccgcgaggcgctgtggacctcgggctacaacacgaacacggacagctacaagtacatc
gctgccgtgaacaagctgcgcaagtttgtcaagaaccgggccgacaagccgctcacgacg
cagctcacctcgctgttcgacaacagcggcagctgggcgttcaacaagggcaacatgctc
gtcgtgctcagctcggccggccagaacggcggcacgcagattgtcagcatcggctccagc
agcctgcccgccggacaaatgaccaacgtcatcaactgcgccaccatcaacgtcaacagc
ggcggcagcgtcacgatccagctcaacggaggccagccggccatcttctacccgtccagc
agcctcggcggctcgggcatctgcggaaagtag

DBGET integrated database retrieval system