KEGG   Anthracocystis flocculosa: PFL1_00406Help
Entry
PFL1_00406        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00040  Pentose and glucuronate interconversions
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFL1_00406
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     PFL1_00406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 HI0933_like UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 19314539
NCBI-ProteinID: XP_007876093
LinkDB All DBs
Position
Unknown
AA seq 400 aa AA seqDB search
MSAPSTLPGNPAPHAQPLGLDNSLPTQPAKGNTSFVLQEIEKVSFEDRPIVAPARGQVQV
NIRQTGLCASDCHYLHHGRIGDFVVRKPMVLGHESSGIVTAVGEGVDTHKVGDRVALEPG
VPCRSCPICLNGDYNHCPKLEFAATPPYDGTLCTYYNIHSTFAHKVPDTMTLEEASLMEP
LSVAVYSAAMRGQVKAMQNVLVFGAGPIGLLAAAVCKAYSAKRVVVVDVIDSKLEFAKTF
GATSTFKPSMPNAGESKMDASVRNANTLLEQIGDDVLRKEGFDLVLECTGAEPCIQMGVW
ALRPKGRFVQVGMGRSEVEYPITRICVKELEMTGSFRYGAGTYETSIALVANKLIDVTRL
VTHRYLFDDAEKAFATTTRGKGEDGQTAIKVQISQGPGQA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctccctcgacactccccggcaacccggcgccgcacgcccagcctctgggcctg
gacaactcgctccccacccagcccgccaagggcaacacgtcgtttgtgctccaggagatc
gaaaaggtcagcttcgaggaccggcccatcgtcgcaccggcgcgcggacaggtgcaggtc
aacatccgccagacgggcctctgcgcctcggactgccactacctccaccacggccgcatc
ggcgactttgtcgtccgcaagcccatggtcctcggccacgagtcgagcggcatcgtcacg
gccgtcggcgagggcgtcgacacccacaaggtcggcgaccgcgtcgccctcgagccgggc
gtcccctgccgctcctgccccatctgcctcaacggcgactacaaccactgccccaagctc
gagtttgccgccaccccgccctacgacggcaccctctgcacctactacaacatccactcg
acgtttgcgcacaaggtcccggatacgatgacgctcgaggaggcgagcctgatggagccg
ctcagcgtcgccgtctactcggcagcgatgcgcggccaggtcaaggcgatgcagaacgtg
ctcgtctttggcgccggccccattggcctgctggcggcggccgtgtgcaaggcctactct
gccaagcgcgtcgtcgtcgtcgacgtcattgacagcaagctcgagtttgccaagacgttt
ggcgccacctcgacctttaagccctcgatgcccaacgccggcgagagcaagatggacgcg
tcggtgcgcaacgccaacaccctccttgagcagattggcgacgacgtgctgcgcaaagag
ggcttcgacctcgtcctcgagtgcaccggcgccgagccctgcatccagatgggcgtctgg
gcgctccgaccaaagggccgctttgtccaggtcggcatgggccgctccgaggtcgagtac
cccatcacgcgcatctgcgtaaaggagctcgaaatgaccggctccttccgctacggcgcc
ggcacctacgagacctccatcgccctcgtcgccaacaagctcatcgacgtcaccaggctc
gtcacccaccgctacctctttgacgacgccgaaaaggcctttgccaccaccacccgcggc
aagggcgaggacggccagacggccatcaaggtccagatcagccagggacccggccaggcg
tag

DBGET integrated database retrieval system