KEGG   Anthracocystis flocculosa: PFL1_00593Help
Entry
PFL1_00593        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
pfp  Anthracocystis flocculosa
Brite
Translation factors [BR:pfp03012]
 Eukaryotic Type
  Elongation factors
   PFL1_00593
 Prokaryotic Type
   PFL1_00593
Mitochondrial biogenesis [BR:pfp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PFL1_00593
Exosome [BR:pfp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PFL1_00593
  Exosomal proteins of breast cancer cells
   PFL1_00593
  Exosomal proteins of colorectal cancer cells
   PFL1_00593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 19314723
NCBI-ProteinID: XP_007876277
LinkDB All DBs
Position
Unknown
AA seq 477 aa AA seqDB search
MSLLRSHAPKSIARSLAASSRSVSASTAAATPTVARGFQSQATPVGRLASRARIPAAPLA
PRVAIASRLQARGYAAEAGKFNRDKPHMNIGTIGHVDHGKTTLTAAITKVLHEASGSGKF
IDYASIDKAPEERARGITISTAHVEYETGNRHYAHVDCPGHADYIRNMITGAAQMDGAII
VVSATDGQMPQTREHLLLAKQVGIKKLVVFINKVDQVDDPEMLELVEMEMRDLLSTYGFN
GEETPIVSGSALAALEGRNPEIGAQAITKLMEETDRWLDMPPRDLDKPFLMPVEDVFSIP
GRGTVVTGRVERGTIQKGAEIEILGLGNTFKTTLTGIEMFHKQLDQGMAGDNMGALLRGV
KREQVKRGQVMVIPGSIKPVKKFRAQIYVLKKEEGGRYTPFMDNYRPQLFIRTSDVTVAL
HHPPGTEDASEKMVMPGDNVELDGELVHDIALEEGSRFTLREGGKTVGTGIVTMIHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctccgatcccacgctcccaagagcatcgctcgctcccttgccgcttcctcg
aggtccgtctcggcctcgactgccgccgccaccccgaccgtggcacgcggcttccagtcc
caggcgactcctgtcggccgcctcgccagccgcgccaggatccccgccgcaccgctcgct
ccccgcgtcgccatcgcctcccgcctccaggctcgcggctacgccgccgaggccggcaag
ttcaaccgtgacaagccccacatgaacatcggcaccatcggtcacgtcgaccacggaaag
acgaccctcaccgccgccatcacaaaggtcctccacgaggcatcgggctccggcaagttc
atcgactacgcctcgatcgacaaggcgcccgaggagcgcgcccgtggtatcaccatctcc
accgcccacgtcgagtacgagaccggcaaccgtcactacgcccacgtcgactgccccggc
cacgccgactacatccgaaacatgatcaccggcgccgcccagatggacggcgccattatc
gtcgtgtcggccaccgacggacagatgccccagacccgcgagcacctgctgctcgccaag
caggtcggcatcaagaagctcgtcgtcttcatcaacaaggtcgaccaggtcgacgacccc
gagatgctcgagctcgtcgagatggagatgcgcgacctcctctccacctacggcttcaac
ggcgaggagacgcccatcgtcagcggctcggccctcgccgccctcgagggtcgcaacccc
gagattggcgcccaggccatcaccaagctcatggaggagactgaccgatggctcgacatg
ccgccccgtgacctcgacaagccattcctgatgcccgtcgaggacgtcttctcgatcccc
ggccgaggcaccgtcgtcacgggccgtgtcgagcgcggcaccatccagaagggtgccgaa
atcgagatcctcggcctcggcaacaccttcaagacgaccctcaccggtatcgagatgttc
cacaagcagctcgaccagggcatggccggcgacaacatgggcgcgctgctgcgcggcgtc
aagcgcgagcaggtcaagcgcggccaggtcatggtgatcccgggctcgatcaagcccgtc
aagaagttccgcgcccagatctacgtcctcaagaaggaggagggcggacgctacacgccc
ttcatggacaactaccgcccgcagctcttcatccgcacctcggacgtcaccgtcgccctc
caccacccgccgggcaccgaggacgccagcgagaagatggtcatgccgggcgacaacgtc
gagctcgacggagagctggtccacgacattgcgctcgaggagggatcgcgattcaccctc
cgcgagggcggcaagacggtcggcaccggcatcgtcaccatgatccacggatag

DBGET integrated database retrieval system