KEGG   Anthracocystis flocculosa: PFL1_00769Help
Entry
PFL1_00769        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00500  Starch and sucrose metabolism
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFL1_00769
Enzymes [BR:pfp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PFL1_00769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 Inhibitor_I36
Motif
Other DBs
NCBI-GeneID: 19314899
NCBI-ProteinID: XP_007876462
LinkDB All DBs
Position
Unknown
AA seq 564 aa AA seqDB search
MTTDPQSTSDMRGIKGRDAEPLFPPRSSSSHTAPPTRQPPSYHSTSSSSSPLLDPPRSPP
CYPLDPEAMVAIVSKRRASKPFVLLGSAGLALILVVLCAFSGNAEAASISRSLLGLKQEL
SKRTTTVSYAYNRMIANIGGASPSGSSNQVPGVPAGTVIAAPSTANPNYFYAWIRDAALT
MKVVVSQGTLDRTLIENYIKVEKIHQQNSDGSASLGEPKFNPDGSRFTGPWGRPQNDGPA
LRASTLIAYAKRIGLSDPLVTNTLYTPSLTGGSLIKTDLEYVSHHWQDSSFDLWEEVNGQ
HFFNQAVSRRALLDGAKFATSLNDPGAASWYNQQAASIKTSMQSFWNSGSGYVTAYQGVG
GRSGLDCAVMLGALRGWDTTTATAVDTTEFGPASDKILATHKKYVDSFRSLYGINKGAAA
PAAVATGRYQEDVYDGVGTSRGNPWYICTLSSAEIINTAVSVFNSRGSITITSISLPFFQ
QFASGLSTGTFAAGSSQFNNIITGMKTMSKGFVDIVQSHSWTNGSLNEEFNRDTGFNQGA
RDLTWSYAAFVSNDGAANGQFLKV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacccccaatcgacgtccgacatgagagggataaaaggtcgagatgcggag
cccctctttcctccccgctcctcgtcatcccacacagctcctcctacacggcagcccccc
agctaccactccacctcctcctcctcatctcctcttctagacccgccccgctctccccct
tgctaccccctcgatccagaagccatggtcgccatcgtcagcaagcgtcgcgcctcgaag
ccctttgtgctgctcggcagcgccggcctggccctcatcctcgtcgtcctctgcgccttt
agcggcaacgccgaggccgccagcatctcgcgctccctcctcggcctcaagcaggagctt
tcgaagcgcaccaccaccgtcagctatgcctacaaccgcatgattgccaacatcggcggc
gcttcgcccagcggcagctccaaccaggtccccggcgtgcccgccggcaccgtcatcgcc
gccccctcgacggccaaccccaactacttctacgcctggatccgcgacgccgccctcacc
atgaaggtcgtcgtcagccagggcaccctcgaccgcaccctcatcgagaactacatcaag
gtcgagaagatccaccagcagaactcggacggctcggcctcgctcggagagcccaagttc
aacccggacggcagccgcttcacgggcccctggggacgcccccagaacgacggcccggcg
ctgcgcgcctcgacgctcatcgcctacgccaagcgcatcggcctcagcgacccgctcgtt
acgaacaccctctacacgccctcgctcaccggcggcagcctgatcaagaccgacctcgag
tacgtgtcgcaccactggcaggacagctcgtttgacctgtgggaggaggtcaacggccag
cactttttcaaccaggccgtgtcgcgccgcgccctcctcgacggtgccaagtttgccacc
agcctcaacgacccgggcgcagcctcgtggtacaaccagcaggccgcctcgatcaagacg
agcatgcagagcttctggaactcgggcagcggctacgtgacggcctaccagggcgtcggc
ggccgctcgggcctcgactgcgccgtcatgctcggcgccctgcgcggctgggacacgacc
acggccacggccgtcgacacgaccgagtttggcccggcctcggacaagatcctcgccacg
cacaagaagtacgtcgacagcttccgcagcctgtacggcatcaacaagggcgccgccgcc
cccgccgccgtcgccacgggacgctaccaggaggacgtctacgacggcgtcggaacgtcc
aggggcaacccgtggtacatctgcaccctctcgtcggccgagatcatcaacacggccgtc
tcggtgttcaactcgcgcggctcgatcaccatcacgtcgatctcgctgcccttcttccag
cagtttgcctcgggcctctcgacgggcacgttcgccgccggctcgagccagttcaacaac
atcatcacgggcatgaagaccatgtccaagggcttcgtcgacatcgtccagagccacagc
tggaccaacggaagcctcaacgaggagttcaaccgcgacacgggcttcaaccagggcgcc
cgcgacctcacctggagctacgccgcctttgtctccaacgacggcgccgccaacggccag
ttcctcaaggtctaa

DBGET integrated database retrieval system