KEGG   Anthracocystis flocculosa: PFL1_00921Help
Entry
PFL1_00921        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K10256  omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase) [EC:1.14.19.6 1.14.19.22]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp01040  Biosynthesis of unsaturated fatty acids
pfp01100  Metabolic pathways
pfp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFL1_00921
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pfp01004]
    PFL1_00921
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.6  acyl-CoA (9+3)-desaturase
     PFL1_00921
    1.14.19.22  acyl-lipid omega-6 desaturase (cytochrome b5)
     PFL1_00921
Lipid biosynthesis proteins [BR:pfp01004]
 Desaturase
  Omega
   PFL1_00921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF3474
Motif
Other DBs
NCBI-GeneID: 19315050
NCBI-ProteinID: XP_007876613
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MSTAAAPNVTAATQRAGKAAPVAAGSNEAAKPTKYSHKQAQPYNEDELAKFNVPSFTVKD
LLSAIPAHCFERSAFKSFTYVFYDLAMVAALGYAATYIDPSVGSYFSQNKANALTPYLSL
GVQQNLARFALWSVYWVLQGLVFTGLWVIAHECGHQSFSTSKTLNNAVGWVLHSALLVPY
HSWRISHARHHAATGHLTRDEVFVPRTRSQKGLLPLKPAAKAGSDAGEDEEVVSEEETWG
EWLKETLEDAPAYNLFYIFIQQLFGWPLYLIQNASGQLHYPKFTNHFNPEAIIFDKRHRS
QILISDLGIACTLAAMAFGASVAPRGFTDVFRYYLIPYLWCNHWLVMITYLQHTDPMLPH
YKAETWTFPRGALCTIDRQWLGPVGPYLLHGISETHVLHHVSSKIPHYHAWEATEALKAR
LGEHYAKSTENVFVSLWKSIRECKYIEESDQVAFYRNGKGVPKRTVSPDSGYNSDSAIAM
SE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgcggctgcgcccaacgtcacggccgctacccagcgtgccggcaaggcggcc
cccgttgctgctggcagcaacgaggcagccaagcccaccaagtactcgcacaagcaggcc
cagccttacaacgaggatgagctcgccaagttcaatgtcccctcgttcaccgtcaaggac
ctgctctccgcgatccccgcccactgcttcgagcgctcggcgttcaagtcgttcacctac
gtcttttacgaccttgccatggttgcggctctcggctacgctgccacctacatcgacccc
tcggttggctcctacttctcgcagaacaaggccaacgccctgaccccctacctctcgctc
ggcgtccagcagaacctggcgcgctttgccctctggtcggtctactgggtgctgcagggc
ctcgttttcaccggcctctgggttatcgcccacgagtgcggccaccagagcttcagcacc
agcaagacgctcaacaatgccgtcggctgggtgctgcactcggccctcctcgtcccctac
cactcgtggaggatttcgcacgcccgtcaccacgccgccaccggtcacctcacccgcgac
gaggtcttcgtgccccgcacccgctcgcagaagggtcttctccccctcaagcctgcggcc
aaggccggatccgacgccggcgaggatgaggaggtcgtctccgaggaggagacctggggc
gagtggctcaaggagacgctcgaggacgctcctgcctacaacctcttctacatcttcatc
cagcagctcttcggctggcccctctacctgatccagaacgcctcgggacagctccactac
cccaagttcaccaaccacttcaaccccgaggccatcatctttgacaagcgccaccgttcc
cagatcctcatctccgaccttggcattgcctgcaccctcgcggccatggccttcggcgcc
tcggtggcccctcgcggcttcaccgacgtcttccgttactacctcatcccctacctctgg
tgcaaccactggctggtcatgatcacctacctccagcacaccgaccccatgcttccccac
tacaaggccgagacctggaccttccctcgcggcgccctgtgcaccatcgacaggcagtgg
ctcggccccgtcggcccttacctcctccacggcatctctgagacccacgttctgcaccac
gtctcgagcaagatcccgcactaccacgcttgggaggccaccgaggcgctcaaggcgcgc
cttggcgagcactacgccaagagcaccgagaacgtctttgtctcgctgtggaagtcgatc
cgcgagtgcaagtacatcgaggagtcggaccaggtcgccttttaccgcaacggcaagggc
gtccccaagcgcaccgtctcgcccgacagcggctacaactcggactcggccatcgccatg
tccgagtaa

DBGET integrated database retrieval system