KEGG   Anthracocystis flocculosa: PFL1_01051Help
Entry
PFL1_01051        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K11566  DASH complex subunit ASK1
Organism
pfp  Anthracocystis flocculosa
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfp03036]
    PFL1_01051
Chromosome and associated proteins [BR:pfp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    DASH complex
     PFL1_01051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DASH_Ask1 SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 19315179
NCBI-ProteinID: XP_007876742
LinkDB All DBs
Position
Unknown
AA seq 951 aa AA seqDB search
MYGQPRQSLYPGGPGGIDMAASTATSSSGPANVPISTQILQLDQEITTVLQEIDQNFTTC
HQIVTSRILPAVNRYGVASARTWQGAKFWKHFFEVSADVALTARVDDQGDGYDDGDTGQG
NASYEQSTTLDGESEAHTTFHSDDVTASPRSDAGTELYDQSIDQPHPRRGARHGAAATGD
DSGEISAFDSAAAGPRRSSPPRFSNASMAAAARREADKKKQQQQQQQQQQDLDGGDASFA
DPTESPFERLRRDLTQDLGRPDDSNNDSILHAHEKQSALASRGSGANRVYYDDVTNDQTI
EVDRSQLAQDVENLDISRTGYHGAGDVSGSSSIAPPPRLSKPIGSSSPGRHAKRPAATTP
RSRGPLLNKVLNSEQRKRDAGGSGRRPRDSLPRFEVTPRGSSSASNPFAQPASVKMWNGI
VDLRKTPLTSRMQKSKGSAGNNGGGASGNRGKEPSRRDNGSEWDSAEEDGEDNNSYAWPA
GMSPPMTMQFSVPQSKYAKTPAKEAAKLMVEDLLKSVGATRSVGQANPRAPASASTSKGR
ANSSRETPGQPRGNSAAPGSAASTASSSHPPRAGSARPAGPVDTPLQRSKREAKAVDRAA
AAAGRHRRRDSMPTPPTLTKRGPSLSAAGGGGATSSRPRMSTTPEVTPQAGSFAANSSGS
LLRRGPAGAGLDGSEASSAAAMLMDEDEGLTTGRGRRAMGPSSSDDGYDDEEEEQEVPAN
LGTKLSAVALQSQMGGAAASAAGGGAAVHALPEEDEDSSEDSSLDSDDDDEEDDEDDDGG
LQAPGSVASSRFSSSSNNYNNQPGNANVTATATGTGWSTSSFSSNSRVGGGGARSIEDDT
LFGVPKPQPRDEGASGGGGGGGGAGLRNPFSSLAPSSSSSATAAAAAAAGGGARRGGAGD
GEGGGAARDFVVWGQVDEMGTVHGGRPLIDRDDTYSAPSPTPMHFSQAARR
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgtacggccagcccagacagtcgctctacccgggcgggccaggcggcatcgacatggcc
gcatcgacggccacttcgtcctctggccccgccaacgtgcccatctcgacgcagatcctc
cagctcgaccaggagatcaccactgtcctccaggagatcgaccagaacttcaccacctgc
caccagattgtcacatcccgcatcctcccggccgtcaaccggtacggcgtcgcaagcgct
cgcacgtggcagggcgccaagttctggaaacacttcttcgaggtctcggccgacgtcgcc
ctcaccgcccgcgtagacgaccagggcgacggctacgacgacggagatacgggccagggc
aacgcttcgtacgagcagagcaccacgctcgacggcgagtccgaggcgcacaccaccttc
catagcgacgacgtcacggcctcgccccgctccgacgccggcaccgagctctacgaccaa
tccatcgaccagccccaccctcgcaggggcgccagacacggcgcggcggcaacaggcgac
gacagcggcgagatcagcgcctttgattcggctgcggctggcccgcgtcgcagctcgccg
cctcgcttcagcaatgcctcgatggcggcagcggcccgtcgcgaggcagacaagaagaag
cagcaacaacaacaacagcagcagcagcaggacctcgatggcggcgacgcctcgtttgcc
gatccgacagagtcgccgtttgagaggctgcgacgtgatctcacccaggatctgggccga
ccagacgacagcaacaacgacagcatcctccacgcccacgaaaagcaatcggcccttgca
tccaggggcagcggtgccaaccgcgtctactacgacgacgtcacaaacgaccagaccatt
gaggtggatcgctcgcagctggcacaggacgtagagaacctcgacatctctcgcaccgga
taccacggcgcaggcgacgtctccggctcgtcttcgatcgcaccgcctccgcgactctcg
aagccgatcggctctagctcgcccggccgccacgcaaagcggcctgccgccaccacgccg
cggtcccgcggtccgctgctcaacaaggtgctcaactcggagcagcggaagcgcgatgcc
ggcggctcaggccgccggccgcgcgactcgttgccacgcttcgaggtgactccgcgtggc
agctcgtctgcctcgaacccgtttgcgcagcctgccagcgtcaaaatgtggaacggcatc
gtggacctgcgaaagacgccgctcacctcgagaatgcaaaagagcaagggcagcgccggc
aacaacggcggcggtgccagcggcaaccgaggcaaagaaccgagccggcgcgacaacggg
tcggagtgggactcggcagaagaggatggcgaggacaacaactcgtatgcttggccggca
ggcatgtctccgcccatgacgatgcagttctcggtgccgcagagcaagtacgcgaagacg
ccggccaaggaggcggccaagctcatggtcgaggatctcctgaagagcgtaggcgccacg
aggtcggtcggacaggccaatcctcgagcgccggcttcggcatcgacgtcgaaaggccgc
gcaaacagcagcagggagacgccgggccagccaaggggcaactcggccgcacccggcagc
gccgccagcactgccagcagcagccacccgccgcgggcaggctcggcccggcctgcaggt
cccgtagacacgccactgcagcgaagcaagagggaagcgaaggccgtggacagggcggca
gcagcggcgggacggcatcgccgtcgagattccatgccgacgccgccgacgctgaccaag
aggggtccgtcgctctcggcagctggtggtggcggcgcgacgtcgtcgaggcctcgcatg
tcgacgacacccgaggtgactccgcaggccgggtcgtttgccgccaactcgagcggcagc
ctgttgcgccgtggacctgccggcgccggtctggacgggtcggaagccagcagcgcggcg
gcgatgctgatggacgaagacgagggtctcacgacgggacgaggacgacgggcgatggga
ccttcttcgtccgatgacgggtacgacgacgaggaggaggaacaggaggttcctgccaac
ctcggcaccaagctgagcgcagtggcgctccagtcgcagatgggcggtgccgccgcctct
gccgcaggcggaggggcggcggtgcacgcgctgccggaggaggacgaagactcgtccgag
gactcgtcgctcgactcggacgacgatgacgaggaggacgacgaagacgacgacggcggt
ctccaggcgccgggatccgtggcgagctctcgcttctcctcgtcttccaacaactacaac
aaccagccgggcaacgccaacgtcacggcgacggcgacggggacgggctggtcgacgtct
agcttctcctccaactcgcgcgtcggcggcggtggggcgaggagcatcgaggacgatacg
ctgtttggcgtgcccaagccccagccgcgcgacgagggggcgagcggtggcggcggtggc
ggcggtggtgcggggctgaggaacccgttcagctcgctcgcaccgtcctcctcgtcatcg
gcgacggcggcagcggcagcggcggcgggcggaggtgcgagacgaggaggagcgggcgat
ggagaaggtggcggtgcagcaagagactttgtcgtctggggccaggtcgacgagatgggc
accgtacacggcggtcggcctttgattgatcgagacgatacctactcggcgcccagcccg
acgccgatgcacttcagtcaggctgcgcgacgatga

DBGET integrated database retrieval system