KEGG   Anthracocystis flocculosa: PFL1_01531Help
Entry
PFL1_01531        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Motif
Pfam: VHS
Motif
Other DBs
NCBI-GeneID: 19315656
NCBI-ProteinID: XP_007877232
LinkDB All DBs
Position
Unknown
AA seq 1268 aa AA seqDB search
MKRLFKPKDANVITPLPLGDESRDPPQLQQRDYLPPSPSPFPSDYDFRAGQGAQPGFPPD
AESTPSSRRQQQRHSSHQPPIRSPYSNPPLQSHRSRDPLQQPSAFPAPQFSPSGRPQSYQ
LFDAGPQPRPHDGGRQPFQQHQHHPSAPSNYPVSPRGHPAATLVGTPTGNGPAGRSRVVG
QAETAADAWPSRRQSSSGHASGAVDSDRDTDSDDESAYRQSRVLNSLVPRTTNHAAIGAD
PDVAMSGSGHGGHGSGSSGHARMENSSSGMPGRASQPMGPHHSNQGSVASRTSVERPPWN
SAEGRPPSSLQRERSTGEGEGVARRGALGMRRWRSTRKQRDQASVGGEGVTDGYLDQPDG
EAQPQRSSWRFGRAGGGGGGSGPTPAAYPVYAGQGEEGPETLLSVGSTGSRDRRLDPAEP
SADRKKGRAKGPKKLFGFGSDGKESKGPAARVNGAPAAGPEAEDRGDVPYHSYAPDARPD
LLTAQHGERLERSLPPTPSSPQPAAAASSSASSSRKDHWYDRKAKKKGNKLSKEAERELE
GIVTAKVGWLCAQQTAADDWEVVLSLAEAVSYSEAASKEAARALRKEFKYGTMPAQKRAA
RVWAVLTMNSSDRFKLQIASKRFLDVVEETISSPKTPLSVKETMLRVLGVLAYEFRTDSE
LSSVTRCWNKVKPSDRPIGGEALSPDLEEFSLAGGGGGGGANEVQPSFARQASNHEQWQP
RSGAMMADMAAADADAPPPLLRPHMDRNHASFDRRHAAPSHASGPTAAAARTTTALPPMQ
PFDRHPADVPSPGSFGAMPTLDADVRKLHEECQIARSNANVLIETMLNEGMRPDTLELID
EFHRKAVDSQEFLMSQVPWASAQADRSRDAPDQERAATGAAPPSESTWQERLLSDLLESH
GRCVEAARMVDEARQQAEADEEERRVTELSKVEVRVDRSALVEDAETGELYYNSNSGAGR
RHAADDRAGAAMGGTSSGGSGINGAGYLGAGPAESSGSRSPSPYHAMGAAGSSAGGSGGR
LSQSSAALPSMALPTSPTPSQQAAFASSPLPHQQPRVSRPLPVPGSDRSSSHGHDRQSAT
SQASYAASSSAGSINGASGGDAESAAHSRQASSASSLAFASRNPYASLAPSSVSAEAAVA
AAATAGGAATNPFARAGDIDVDPLALRIGSAFNLGPSPPSSNMAPPTRPTINTGAPQPHP
PPLPPHPRTRGQAESTDRPRQRHGGHDNGGDDRGDDDDDDDGDSILTPIVPSEKALGKRR
QVSVRLSE
NT seq 3807 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgactcttcaaacccaaggacgccaacgtcatcacgccgctgccactgggggac
gagtcgcgggacccgccccagctgcagcagagagactacctgcccccctccccgtcgccc
tttccttccgactacgacttccgcgccggtcaaggggcgcagccgggcttcccgcccgac
gccgagtcgaccccctcctctcggaggcagcagcaacgacacagctcgcaccagcctccc
atccgttcgccgtacagcaaccctcccctgcagtcgcatcgctcgcgtgacccgcttcag
cagccatcggcctttcccgccccccaattctcgcccagcggccgtccgcagtcgtaccag
ctgttcgatgcagggcctcagccgcggccacacgacggaggccgacaacccttccagcag
caccagcaccatccctcggcgccgagcaactatcccgtctcaccacgcgggcatcctgcg
gccaccttggtgggcacgccgacggggaacgggcctgctggccgctcgagggttgtcggc
caagcagagacggccgcggatgcctggccctcacgccgccagtcgagctctggtcatgcc
agtggcgcagtcgacagcgacagggacaccgacagcgacgatgagtcggcctatcggcaa
tcgcgggtcctcaatagcctggtgcccagaacgacgaatcacgccgcaatcggtgcggat
ccggacgtcgcgatgtccggcagcggccacggtggccacggttccggctcctcgggccac
gctcgcatggagaactcctcgtcgggaatgccaggcagggcgtcgcagccgatgggtcca
caccattccaaccagggtagcgtggcatcgcggacctctgtcgaacgcccgccgtggaac
tcggcagagggccgaccaccgtcgagcctgcagcgggaacgcagcacgggagagggcgag
ggcgtcgcacggcgtggggcgctgggcatgcggagatggaggagcacccgcaaacagcgc
gaccaggccagcgtcggcggcgagggcgtgacggacggatacctggaccagccagacggc
gaggcgcagccacagagaagcagttggcgctttggtcgcgccggcggtggcggtggcggc
agcggcccgacaccggcggcctatcccgtctatgccggtcaaggagaagaaggtccagag
acgcttctctccgtcggctccacaggctcgcgcgaccggcgactcgaccccgcagaaccg
tcggccgaccggaaaaagggtagagccaaaggccccaagaagctctttggcttcggcagt
gacggcaaggaatccaaaggacccgccgcccgcgtcaatggggccccagcggcaggccct
gaagcggaggatcgaggcgacgtgccctaccacagctacgctccggatgcccggccggac
ctcttgacggcgcaacacggcgagcgcctggaacgcagtctcccgcccacgcccagctca
ccgcagcccgcggccgcggcttcgtcgtcggcgtcgtcgtcgcgcaaggaccactggtac
gaccgcaaggccaaaaagaagggcaacaagctgagcaaggaggcagagcgggagctcgag
ggcatcgtcaccgcaaaggtgggctggctctgcgcacagcagacggcggccgacgactgg
gaggtggtgctttcgctggccgaggcggtgagctactcggaggcggcgagcaaggaggcg
gcccgggcgctgcgcaaggagttcaagtacggcacgatgcccgcgcagaagcgcgccgcc
agggtgtgggcggtgctcacgatgaactcgagcgaccgcttcaagctgcagattgcctcg
aagcggttcctggacgtcgtcgaggagacaatctcgtcgccaaaaacgccgctcagcgtc
aaggagacgatgctgcgggtgctcggcgtgctcgcgtacgagttccgcaccgactcggag
ctcagcagcgtcacgcgatgctggaacaaggtcaagccgagcgatcggcccatcggcgga
gaggcgctgagcccggaccttgaggagttttcgttggctggcggcggcggcggcggcggc
gccaacgaggtgcagcccagctttgcccggcaggcatcgaaccacgaacaatggcagccc
cgatcaggtgcgatgatggccgacatggcggcggcggacgcagatgccccaccacccttg
cttcggccgcacatggatcgcaatcacgcctccttcgaccgccgtcatgctgcaccctcg
cacgcttctggaccaacagctgcggcggcgaggacgacgaccgctctgccgccgatgcag
cccttcgaccgccacccggcagacgtgccgtcgccaggctcgtttggcgccatgccgacc
ctcgacgccgatgtccgcaagctgcacgaagagtgccagattgcccgcagcaacgccaac
gtgctcatcgagacgatgctcaacgaaggcatgcgcccagacacgctcgagctgatcgac
gagttccaccgcaaggccgtcgactcgcaggagttcctcatgtcgcaggtgccgtgggca
agcgcccaggcggaccggtccagggacgcccccgatcaggagcgggcggccacgggcgct
gcgccgccgtcggagtcgacgtggcaggagcgcctcctgtcggacctactggagtcccat
ggcaggtgcgtcgaggcggccaggatggtcgacgaggcgcgccagcaggccgaggcggat
gaggaggagcggcgggtgacggagctcagcaaggtcgaggtgagggtggaccgcagcgcc
ctggtcgaggatgccgagacgggtgagctctactacaactccaacagcggcgctggacgt
cgccacgctgcggacgacagggcgggagctgccatgggcggcaccagcagcggcggcagc
ggcatcaatggagcaggctacctcggtgctgggccggcagagtcctcgggttcgagatcg
ccgtctccataccatgccatgggtgccgctggatcgtcggctggcggaagcggcggcagg
ctatcccagtcgtcggcagccttgccgtcgatggcactgcccacatcgccgacgccgtcg
cagcaggccgcctttgcatcgtcgccgctgccacaccagcagccgagggtctctcggccc
ctgcccgtccccggatcagacaggtcgtctagccacggccacgatcggcagtcggcgact
tcgcaggcgtcgtacgcagccagcagctcggctgggtcgatcaatggcgccagcggcggt
gacgccgagtctgcggcccattctcggcaggcgtcgagcgcgtcttcgctggcgtttgcg
tctcgcaacccgtacgccagcctggccccgtcgtcggtcagcgccgaggcggcggtggcg
gcagcagcgacggcgggaggcgcggcgaccaacccatttgcccgggccggcgacatcgac
gtggacccgctggcgctgcggatcggcagcgcctttaacctgggcccctcgccgccgtcg
tcgaacatggcgccaccaacgcgcccgacgatcaacacgggtgcgcctcagccgcacccg
ccgccgctgccgccgcatccccggacccgcggacaggccgagtcgacggacaggccacgg
cagcggcatggcggtcacgacaacggcggcgacgaccgcggcgacgacgacgacgatgac
gatggcgactcgatcctgacgcccattgtgccgtcggaaaaggcgctgggcaagcggcgc
caggtgagcgtgcgtctgtcggaataa

DBGET integrated database retrieval system