KEGG   Anthracocystis flocculosa: PFL1_01580Help
Entry
PFL1_01580        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00052  Galactose metabolism
pfp00500  Starch and sucrose metabolism
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PFL1_01580
   00500 Starch and sucrose metabolism
    PFL1_01580
Enzymes [BR:pfp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PFL1_01580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19315705
NCBI-ProteinID: XP_007877281
LinkDB All DBs
Position
Unknown
AA seq 925 aa AA seqDB search
MRTSFAALASLVALATSLAAANPVLVPRQDAKEVPPKFIPSPVEHTADVDSCPGYAASDV
KTTAHGLTATLRLAGDPCSAYGPDYPVLKLAVNYDSQDRLRVRITDAENKAHVVPQDIGR
YPEFGSTGVSKDKSKLKFEHVDSPFSFKVSRGDEVLFDTAGSPLIFEEQYVRLRTSLPEN
ASIYGVGDHNDNLRLPITQANYSRTLWARDAYGVPSRTNLYGSHPIYFDHRLTDSGPSTH
GVFLLTSNGLDVKFPDGGRALEYNTLGGIIDLFFMQGPDPTSVAKQYTDVIGRPVGSPYW
GLGLHQCRYGYRDVYEVAEVVANYSAAGIPLETMWTDIDYMDKRAIFTTNPDNYPLDKVR
SLVDTLHDNDQHYVLMIDPAMAVRDNYPSLERAKEQDVLLKNEDGSLYDSGVVWPGRVVF
PDWFAANTSKWWTSEVERFFSPKTGVDVDAIWIDMNEPASFLPYLEANPDRVSEEKNLPP
VAPPVRNPPPRVPGFFQKRQSDEASAQLDNKWLYPPYRINDVRAAPSGADGVVDAGVSKN
ISDFTASTALVHANGEREYDVHNIYGHMMGAETRKALLNRRPGERPLIITRSTFAGSGNS
TGKWLGDNLSEWAGYTSTIRQMLAFASIYQIPVVGADTCGFGNNATETLCARWAFLGAFS
PFFRNHNGEPPNIGQEFYRWPLVTEAAKKALDIRYRLLDYLYTALHEAEQTGKPVLSPLF
YKHPADAQTFGIETQFYYGDHLLVSPAMAENSTTAEFYVPDDLFYDFFTLQPVRGEGKNV
TQKAEYTDIPLHIRGGAVVPMRSEGAMTTTELRTRDFTLVVAPDAEGRASGYLRLDDGVS
IHSKTASDIRFAFADDKLTVDGSFGYRTKVHFDKVVFANVDRARSAVLGGKKVDAKSVVY
SAENRTLTLSGLKFKIQRGFTIRLE
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctcgtttgccgccctcgcctcgctcgtggccctcgccacgtcgctggccgcc
gccaatccggtgctcgtgccccgccaggacgccaaagaggttccccccaagttcatccct
tcgcccgtcgagcacaccgccgacgtcgacagctgccccggctatgccgcctcggacgtc
aagaccacggcccacggcctcaccgccaccctccgcctcgccggagacccctgcagcgcc
tatggcccagactaccccgtcctcaagctcgcagtcaactacgacagccaggaccgcctg
cgcgtgcgcatcaccgacgccgagaacaaggcccacgtcgtgccccaggacattggccgc
taccccgagttcgggtccacgggcgtctccaaggacaagtccaagctcaagtttgagcac
gtcgactcgcccttttccttcaaggtcagccgcggcgacgaggtcctctttgacacggcc
ggctcgcccctcatcttcgaggagcagtacgtccgcctgcgcacctcgctccccgaaaac
gcctccatctacggcgtcggcgaccacaacgacaacttgcgcctgcccatcactcaggcc
aactacagccgcaccctgtgggcccgcgatgcctacggcgtcccctcgcgcaccaatctg
tacggctcgcaccccatctacttcgatcaccgcctcaccgattcgggcccctcgacccac
ggcgtcttcctgctgaccagcaacggcctcgacgtcaagttccccgacggcggaagggcg
ctcgagtacaacaccctcggcggcatcatcgacctctttttcatgcagggacccgacccg
acctcggtggccaagcagtacaccgacgtgatcggccgccccgtcggctccccctactgg
ggtctcggcctgcaccagtgccgctacggctaccgcgacgtctacgaggtcgccgaggtc
gtcgccaactactcggccgcgggcatcccgctcgagacgatgtggaccgacatcgactac
atggacaagcgcgccatcttcaccaccaacccggacaactacccgctcgacaaggtccgc
tcgctcgtcgacacgctccacgacaacgaccagcactatgtgctcatgatcgaccccgcc
atggccgtgcgcgacaactacccctcgctcgagcgcgcaaaggagcaggacgtgctcctc
aagaacgaggacggttccctctacgacagcggcgtcgtctggcccggacgcgtcgtcttc
ccggattggttcgccgccaacacgagcaagtggtggaccagcgaggttgagcgcttcttt
agccccaagaccggcgtcgacgtcgacgccatctggatcgacatgaacgagcccgcctcg
ttcctgccctacctcgaagccaacccggaccgtgtgtcggaggaaaagaacctgcctccc
gtcgccccgccggtgcgcaaccctccgcctcgcgtgcccggctttttccagaagcgtcag
tcggacgaggcgtcggctcagctcgacaacaagtggctctacccgccctaccgcatcaac
gacgtccgcgccgctccctcgggcgctgacggtgtggtcgatgcgggcgtctcgaagaac
atctcggactttacggcgtccacggcgctcgtccacgccaacggcgagcgcgagtacgac
gtccacaacatctacggccacatgatgggcgccgagacgcgcaaggcgctgctgaaccgt
cgtccgggcgagcggccgctgatcatcacgcggtcgaccttcgccggttcgggcaactcg
acgggcaagtggctgggcgacaacctgagcgagtgggcgggctacacgagcacgatccgg
cagatgctggcgtttgcgtccatctaccagatccccgtcgtgggcgccgacacgtgcggc
tttggcaacaacgccaccgagacgctgtgcgcgcgctgggccttcctgggcgcgtttagc
ccctttttccgcaaccacaacggcgagccgcccaacattggccaggagttctaccgctgg
ccgctggtgaccgaggcggccaagaaggcgctcgacatccgctaccgcctgctcgactac
ctgtacacggcgctgcacgaggccgagcagacgggcaagccggtcctctctccgctcttc
tacaagcatcccgccgacgcgcagacgtttggcatcgagacgcagttctactacggcgac
cacctgctcgtctcgcccgccatggccgagaacagcaccacggccgagttctacgtgccc
gacgacctcttttacgactttttcacgctccagcccgtgcgcggcgagggcaagaacgtg
acgcaaaaggcagagtacaccgacatcccgctccacatccgcggcggcgccgtggtgccg
atgcgctccgagggcgccatgacgacgaccgagctgcgcacgcgcgactttacgctcgtc
gtcgcgcccgacgccgagggcagggcgtcgggctacctccgcctcgacgacggcgtctcg
atccacagcaagacggcctcggacatccgcttcgcctttgccgacgacaagctcaccgtc
gacggctcgtttggctacaggaccaaggtgcactttgacaaggtcgtctttgccaacgtc
gaccgcgcgcgctcggccgtgctcggcggcaaaaaggtcgacgccaagtcggtcgtctac
agcgccgagaacaggaccctcaccctgtccggcctcaaattcaagatccagcgcggattc
accatccgtctcgagtag

DBGET integrated database retrieval system