KEGG   Anthracocystis flocculosa: PFL1_02063Help
Entry
PFL1_02063        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00020  Citrate cycle (TCA cycle)
pfp00480  Glutathione metabolism
pfp01100  Metabolic pathways
pfp01110  Biosynthesis of secondary metabolites
pfp01130  Biosynthesis of antibiotics
pfp01200  Carbon metabolism
pfp01210  2-Oxocarboxylic acid metabolism
pfp01230  Biosynthesis of amino acids
pfp04146  Peroxisome
Module
pfp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFL1_02063
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFL1_02063
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PFL1_02063
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PFL1_02063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19316185
NCBI-ProteinID: XP_007877765
LinkDB All DBs
Position
Unknown
AA seq 506 aa AA seqDB search
MPSCRIATTAASRGLQLGSRGFSTTSSAAAHLARPHRPMLELGRASHSPLLASRGAAAAY
APAASASGPASSFHQALAMRSFSSTMTAAKIKVANPVVELDGDEMTRIIWHKIREELILP
FLDIDLKYYDLGMEHRDATDDKVTVEAAEAIKKYKVGVKCATITPDEARVKEFGLKKMWL
SPNGTIRNILGGTVFREPIVVENIPRPVPGWTKPIIIGRHAFGDQYRCQNFVAPGKGKFT
MTFQPEDSSQPAQHFDIFNFPEGGGVGMGMYNTTESITGFAHACFKMALSSGYPMILSTK
NTILKAYDGKFKDVFQEIYDTQYKKEFDAKGIWYEHRLIDDAVAQIIKGDGGMVWACKNY
DGDVQSDIVAQGFGSLGLMTSVLLTPDGEICESEAAHGTVTRHYRQHQKGQETSTNSIAS
IYAWTRGLAHRGKLDQNEELVTFAKELEKACIDCVNNNQLTKDLALSLHGKNLKREHYLS
TEEFLDAVRDRLTNALKKQGIEAGKL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgccctcttgccgcatcgccaccacagccgccagccgcggcctccagctcgggtcgcgt
ggcttctcgacgacgtcgtctgcggctgcccatctggcccgcccccatcgcccgatgttg
gaactcggtcgtgcgtcccactcgccgcttctggcgtctcggggcgccgccgctgcctac
gctcctgccgcatcggcgtcgggcccggcctcaagcttccaccaggcgctcgccatgcgg
agcttctcgtcgaccatgactgccgccaagatcaaggtggccaaccccgtcgtcgagctc
gatggcgatgagatgacccgcatcatctggcacaagatccgcgaggagctcatcctgcct
ttcctcgacattgacctcaagtactacgacctcggcatggagcaccgcgacgccaccgac
gacaaggtcaccgtcgaggccgcagaggccatcaagaagtacaaggtcggcgtcaagtgc
gccaccatcacgcccgacgaggcgcgcgtcaaggagtttggcctcaagaagatgtggctc
agccccaatggcaccatccgcaacatccttggcggtaccgtcttccgcgagcccatcgtc
gtcgaaaacattccccgccccgtccccggctggaccaagcccatcatcatcggacgccac
gcctttggcgaccagtaccgctgccagaactttgtcgccccgggcaagggcaagttcacc
atgaccttccagcccgaagactcgtcgcagcccgcccagcactttgacatcttcaacttc
cccgagggcggaggcgttggtatgggcatgtacaacacgaccgagtccatcaccggattc
gcccatgcctgcttcaagatggcgctctcgtcgggctaccccatgatcctctcgaccaag
aacaccatcctcaaggcctacgacggcaagttcaaggacgtcttccaggagatctacgac
acccagtacaagaaggagtttgacgccaagggcatctggtacgagcaccgcctcatcgac
gacgccgtcgcacagatcatcaagggtgacggcggcatggtgtgggcgtgcaagaactac
gacggcgacgtccagtccgacattgttgcccagggcttcgggagcctcggcctcatgacc
tcggtcctcctcacgcccgacggcgagatctgcgagtccgaagccgctcacggcaccgtc
acccgccactaccgccagcaccagaagggacaggagacgtcgaccaactcgattgcgtcg
atctacgcctggacccgcggtctcgcccaccgtggcaagctcgaccagaacgaggagctc
gtcacttttgccaaggagctcgagaaggcgtgcatcgactgcgtcaacaacaaccagctc
acaaaggacctcgccctcagcctgcacggcaagaacctcaagcgcgagcactacctcagc
accgaggagttccttgacgccgtccgcgaccgcctgaccaacgcgctcaagaagcagggc
atcgaggccggcaagctctag

DBGET integrated database retrieval system