KEGG   Anthracocystis flocculosa: PFL1_02896Help
Entry
PFL1_02896        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00010  Glycolysis / Gluconeogenesis
pfp00051  Fructose and mannose metabolism
pfp00052  Galactose metabolism
pfp00500  Starch and sucrose metabolism
pfp00520  Amino sugar and nucleotide sugar metabolism
pfp01100  Metabolic pathways
pfp01110  Biosynthesis of secondary metabolites
pfp01130  Biosynthesis of antibiotics
pfp01200  Carbon metabolism
Module
pfp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pfp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL1_02896
   00051 Fructose and mannose metabolism
    PFL1_02896
   00052 Galactose metabolism
    PFL1_02896
   00500 Starch and sucrose metabolism
    PFL1_02896
   00520 Amino sugar and nucleotide sugar metabolism
    PFL1_02896
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PFL1_02896
Enzymes [BR:pfp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PFL1_02896
Membrane trafficking [BR:pfp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PFL1_02896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF1509
Motif
Other DBs
NCBI-GeneID: 19317009
NCBI-ProteinID: XP_007878600
UniProt: A0A061HGA5
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MVAQQPQAQEDKPRRGSTSLASRRRGSGTEKLDTHIASWHTRTHDGGKTPHAREEDLKKL
YEKYEKIFSITPQRLRMITDRFVGVLEEGLKKPDQTVPMLPAFVFGWPTGEEVGSYLALD
LGGTNLRVCHVVLKGQGKFEITQTKFRLTEEQKQIEGQELFDFCAECLDTFVKDHFGDAN
GEVILEEEIALGFTFSYPMSQDRIDHGKLIRWTKGFGNPNTEGRDCAAMFRASLEKYGVP
IKMTSLINDTTGTLIASNYVNKDTRIACIFGTGCNAAYMEHIRDIPKINDLGLPGDQDMA
INCEYGAFDSFTHEHMAEIRTKYDEHIDLHSNKPHEQTYEKMIAGLYLGELFRLVLIELS
DEGDLFLGQNTYKIEKPYAFDTAFLSLIESDPTDELLTVTGLFTHFFGLDTTLEERHFFR
KLARLIGTRAARLSSCGIAALVTKMGYLEQGCGVGADGSLYSKYPGFPDRLHEALEDIFG
EKGKKIRTYQAEDGSGVGSAIIAAMTKARKEAGIHAHV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgcagcagccccaggcgcaggaggacaagcctaggcgcggctcgacctcgctc
gccagtaggagacgtggctccggcacagagaagctcgacacgcatattgcatcgtggcac
acgaggacccacgatggcggcaagactcctcacgcccgagaggaggacctgaagaagctc
tacgagaagtacgagaagatcttctccatcactccgcagaggctgcgcatgatcacggac
cgctttgtcggcgtgctcgaagagggcctcaagaagcccgatcagaccgtgccgatgctt
ccggcctttgtctttggctggcctacgggagaagaggtcggatcgtatcttgccctggac
ctcggtggcaccaacctgcgtgtctgccacgtcgtgctcaagggacagggcaagtttgag
attacccagaccaagttccgcctgacagaggagcagaagcagatcgagggtcaggagctc
tttgacttctgcgccgagtgcctcgacacgtttgtcaaggaccactttggcgatgccaac
ggcgaggtcatcctcgaagaggagatcgcgctcggcttcaccttcagctaccccatgtct
caggatcgcatcgaccacggcaagctgattcgatggaccaagggcttcggcaaccccaac
accgagggtcgcgactgcgccgccatgtttcgcgcatcgctcgagaagtacggcgtgcca
atcaagatgacgtcgctcatcaatgacacgacgggcacgctgatcgcgtccaactacgtc
aacaaggacacgcgcatcgcctgcatctttggcaccggctgcaacgccgcctacatggag
cacatcagggacattcccaagatcaacgacctcggcctgccgggcgaccaggacatggcc
atcaactgcgagtacggcgcctttgactcttttacccacgagcacatggccgagatccgg
accaagtacgacgagcacatcgacctgcactcgaacaagccgcacgagcagacgtacgag
aagatgatcgctggcctctacctcggcgagctgttcaggctggtgctcatcgagctgagc
gacgagggcgacctcttcctcggccagaatacgtacaagatcgagaagccgtacgcgttc
gacacggccttcctctcgctgattgagagcgacccgaccgacgagctgctcaccgtcacc
ggcctcttcacccacttctttggcctggacacgacgctcgaggagcgacactttttccgc
aagctggccaggctgatcggcacgcgggccgcccggctgagcagctgtggcatcgccgcc
ctcgtgacaaagatgggctacctcgagcagggctgcggcgtcggagcggatggcagtctt
tactccaagtaccccggattccccgatcgtcttcacgaggcgctcgaagacattttcggc
gaaaagggcaagaagatccgcacctaccaggccgaggatggctcgggcgtcggttcggcc
atcattgcggccatgaccaaggccaggaaggaggccggcatccacgcgcacgtctga

DBGET integrated database retrieval system