KEGG   Anthracocystis flocculosa: PFL1_03213Help
Entry
PFL1_03213        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 19317323
NCBI-ProteinID: XP_007878919
UniProt: A0A061HA38
LinkDB All DBs
Position
Unknown
AA seq 722 aa AA seqDB search
MFAPAPVRLEPSSYSHAAAAAAAADNTSGISSGSQRSDNQLASVNLSFPPIASLSETMNH
AYGGRGGGMSSSEGSAGWSRSQDDRGASLFATPRAVAAADPGRLLPPASSLVSGAGSNGG
STAVGPSAAGVGQYPPSSSGASESLPPLLYNNGYAAATSDSNLGGGGGGGVGRSFSVESL
TSPASDQQPFLSSASTSNPNDEAYPVGYQQHSAQHAHHHHHGRSFTTPSYSMHPGRAAEA
AGGSTHLSTNPLYLQPYQQQQQPQQQQPHHAPPQQTLPHQQYRGHHHQQLSYRPYDAPSS
YPPMAGYGGGSVVHSNGMHPYGAHAASLEYRSHYFNPFEVKHRRRTTKSQFHVLEGTFKE
IPKPNAALRKALSVQLDMPPRAVQIWFQNRRAKAKALAKKEAASKEAANGGGGGASGEGG
DHGEASNSASASGSSAQAGAASSSSTSHAGNDPRSRLAHSHSDLGLSGHGSSSSTVSGYH
HMAHGSVSSNASDDGQGPSQAPYGAGSSSDAGFLRMPGQHTARPSTMSSTTSSSMATPSY
SDRGRSNDVRANELTFGVQLNRYHHDDSGFPQPASHLQERGGGVRAAPSASTADERYSRL
AYSPQQHQQQHQQQPQHPHHHHHQQQLQQHQQHHQGESGSFYPSGLTSDLSDAATASGGM
HELPGSAMTAASSLFPDDYAQDRRASCPENVASISAAIANPSPDFHPTERGEQQQQQQQQ
PW
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgccagcgcccgtccgactcgagccgtcatcttactcccacgccgccgccgcc
gccgccgccgccgacaacacctctgggatcagcagcggcagtcagcgctccgacaaccag
ctcgcctcggtcaacctctcctttccgcccatcgccagcctgtccgagaccatgaaccac
gcctacggtgggcgaggcggcggaatgtcttcgtcggaaggttccgccggctggagccga
tcccaggacgaccgcggggcctcgctgtttgccacgcctcgcgccgtcgcggctgccgac
cccggtcgccttctgccgcccgccagcagcctggtttcgggtgccggtagcaacggcggc
agcaccgccgttggcccctctgcagcgggcgtcggccagtacccgccctcttcttcgggt
gcctcggaatcgctgccacccctgctctacaacaacggctacgccgcggcgacgtcagac
tcgaacctcggcggcggtggcggcggcggcgtgggccgctcgttctcggtcgagtcgctg
acttcgccggcgtcggaccagcagccgttcctctcctcggcttcgacgtccaatcccaac
gacgaggcctacccggtcggctaccaacagcacagcgctcagcatgcccatcaccaccac
catggtcgatccttcaccaccccgagctattcgatgcatcctggccgtgccgccgaggca
gccggaggctcgacgcacctgtctaccaatcccctctacttgcaaccctaccagcagcag
cagcagccccagcagcagcaaccccaccatgctcctccccagcagacgctgccgcatcag
cagtaccgcggtcatcatcaccagcagctgagctaccgtccctacgatgcgcccagctcg
tatccccccatggccggatacggcggaggcagcgtcgtgcactccaacggcatgcacccc
tacggcgcccatgccgcctcgctcgagtaccgctcgcactacttcaaccccttcgaagtc
aagcaccgccgacgcaccaccaagagccagttccatgtcctcgagggcacgttcaaagag
atccccaagcccaatgccgcgctccgcaaggcgctcagcgtgcagctcgacatgccgccg
cgcgccgtccagatctggttccagaaccgccgggccaaggccaaggccctggccaagaag
gaagccgccagcaaggaggccgccaacggcggcggcggcggcgcaagcggcgagggaggc
gaccacggcgaggcgagcaacagcgccagcgccagcggctcttcagcgcaggcgggcgcc
gcgtcgtcatcgtcgacgtcgcatgccggcaacgacccgcgctcccgcctggcgcactcg
cactctgacctcggcctcagcggccatggcagctcgtcgtcgacggtgtcgggctaccac
cacatggcgcatggcagcgtgtcgtcgaacgcctcggacgacggccagggcccgtcgcag
gcgccctacggggcggggtcgtcgtcggacgccggcttcctgcgcatgcccgggcagcac
acggcgcggccttcgaccatgtcgtcgacgacgtcgtcgtcgatggccacgccctcgtac
tcggaccgcggccgcagcaacgacgtgcgcgccaacgaattgacgtttggcgtccagctc
aaccgctatcaccacgacgactcgggcttcccgcagccggcctcgcacctccaggagcgg
ggcggcggcgtccgcgccgcaccgtcggcatcgacggctgacgagaggtacagccgcctc
gcctactcgcctcagcagcaccagcagcagcaccagcagcagccgcaacacccccaccac
caccaccatcagcagcagctccagcagcaccagcagcaccaccaaggcgaaagcggcagc
ttctacccctctggcctgacctctgacctgtcggacgccgcgacggcgtcgggcgggatg
cacgagctgcccggctcggccatgacggccgcctcgtccctgttccccgacgactacgcc
caggaccggcgcgcctcgtgtcccgagaacgtggcgagcatctcggcggccattgccaac
ccatcgcccgactttcacccaacggaacgaggggaacagcagcagcagcagcagcagcag
ccttggtga

DBGET integrated database retrieval system