KEGG   Anthracocystis flocculosa: PFL1_03409Help
Entry
PFL1_03409        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Motif
Pfam: Hva1_TUDOR
Motif
Other DBs
NCBI-GeneID: 19317519
NCBI-ProteinID: XP_007879117
UniProt: A0A061HER9
LinkDB All DBs
Position
Unknown
AA seq 371 aa AA seqDB search
MMASEYKKRGGGYTTDKSEQDSSQKNLEKWGDEEWQTKDGEGKAKQDDGTEKRYLPKKAW
EQMSEQEKQETDDKKQRESKQGKQFVGNTDKAKDERRKVSEGQKDQDGQEDDEEQGKGAP
KDGAQSQGGKGAGAQAHKGKAANGGKQQKKQQSDGADGDDDDDDDDEQPHEDVEEMQEGD
NDEYQPEDDGADEAGDDQDDEQGDDQGGKQAQKQGGKKGGQSSAKESSGNGGNNNGAAAS
PRRSQRKRSASGGDGGSGDTGEKEGDEQDEGDDEKGSNKKAKTTHGSKHDSTDPPNDRKP
ASASRLPKKGQEVTWKAMPGWVTGIVQEILTSSKKVEGKDVKASKDDPRISLKSNGPSGK
TAIHKPAAVYF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgtccgagtacaagaagcgcggcggcgggtacacgaccgacaagtcggagcag
gactcgtcgcagaagaacctggaaaagtggggcgacgaagagtggcagacaaaggacggc
gagggcaaggccaagcaggacgacggcaccgagaagcgctacctgcccaagaaggcgtgg
gagcagatgagcgagcaggaaaagcaggagaccgacgacaagaagcagagggagagcaag
cagggcaagcagtttgtcggcaacaccgacaaggccaaggatgagcgcaggaaggtcagc
gaggggcagaaggaccaggacggccaggaagacgacgaggagcagggcaaaggtgcccca
aaggacggcgcgcagagccagggaggcaagggagccggcgcacaggcgcacaagggcaag
gccgccaacggtggcaagcagcagaagaagcagcagagcgacggcgccgacggcgacgac
gacgacgacgacgacgacgagcagcctcacgaggatgtcgaggagatgcaagagggcgac
aacgacgagtaccagcccgaagacgatggcgccgacgaggcgggagacgaccaggacgac
gagcagggcgatgaccaaggtggcaagcaggcccagaagcagggcggcaagaaaggcggc
cagtccagcgccaaagagtcgagcggcaacggcggcaacaataacggtgctgccgcgtcg
ccgcgccgctcgcagcgaaagcgttccgcctcgggcggcgacggcggctccggcgacacg
ggcgaaaaggagggtgacgagcaagacgaaggcgacgacgagaaggggagcaacaagaag
gccaagacgacccacggctccaagcacgacagcaccgacccgcccaacgaccgcaagccg
gcgtcggcctctcgcctgccgaaaaagggccaggaggtgacgtggaaggccatgcccggc
tgggtcacgggcatcgtccaagagattctgacgtcgtcgaaaaaggtcgagggcaaggac
gtcaaggcgtccaaggacgacccgcgcatcagcctcaagagcaacggccccagcggcaag
acggccatccacaagcccgccgccgtctacttctga

DBGET integrated database retrieval system