KEGG   Anthracocystis flocculosa: PFL1_04040Help
Entry
PFL1_04040        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00020  Citrate cycle (TCA cycle)
pfp00190  Oxidative phosphorylation
pfp01100  Metabolic pathways
pfp01110  Biosynthesis of secondary metabolites
pfp01130  Biosynthesis of antibiotics
pfp01200  Carbon metabolism
Module
pfp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFL1_04040
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PFL1_04040
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PFL1_04040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 19318147
NCBI-ProteinID: XP_007879755
UniProt: A0A061H6F3
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
MVFARTLSRAVARNPTSSLVAHRSAGFHSTAAASRIIASQPLRAKEAPSIADAAKGYPVI
DHEYDAVVVGAGGSGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGINAALGNMTEDD
WRWHMYDTVKGSDWLGDQDAIHYMCREAPRTVIELEHFGLPFSRTKDGKIYQRAFGGQSL
NYGKGGQAYRCAAAADRTGHAMLHTLYGQSLRHNTNFFIEYFALDLIMEDGECVGVMALN
MEDGTIHRFRSHKTVLATGGYGKAYFSATSAHTCTGDGMAMVSRAGLPLQDLEFVQFHPT
GIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVG
PEKDHVYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYT
GEVITKGPNGEDKVVPGLYAAGETACVSVHGANRLGANSLLDIVVFGRACANHIKENLSP
GKPHKELKGDAGAKSINDLDWARNANGSKPTAQIRNEMQRVMQSDAAVFRTQKTLDEGVE
KIDKVFDSYPDVSIQDRSMIWNSDLVETLELKNLLTCATQTMHSAAARKESRGAHAREDF
PDRDDETWMKHTLSWQQGQNDKVKLDYRNVVNTTLDEAECKPVPPFKRQY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggtctttgccaggacgctctcgcgcgccgtggcgcgcaaccccacctcgagcctcgtc
gctcacaggtcggccggcttccactcgaccgccgccgcatctaggatcattgcatcgcag
cccctccgcgcaaaggaggcaccctcgatcgcagacgccgcaaagggctaccccgtcatc
gaccacgagtacgacgccgtcgttgtcggtgccggtggatccggtctgcgtgccgccttc
ggtctcgccgaggccggcctcaacactgcctgcatcaccaagctcttccccacccggtcc
cacaccgtcgctgcccagggcggtatcaacgctgctctcggaaacatgaccgaggacgac
tggaggtggcacatgtacgacaccgtcaagggatccgactggctcggcgaccaggatgcc
atccactacatgtgccgcgaggcgccccgcaccgtcattgagctcgagcacttcggcctg
cccttctcgcgaaccaaggacggcaagatctaccagcgtgcctttggcggacagtcgctc
aactacggcaagggcggccaggcctaccgctgcgccgccgccgccgaccgcactggccac
gccatgcttcacaccctctacggccagtcgcttcgccacaacaccaacttcttcatcgag
tactttgccctcgacctgatcatggaggacggcgagtgcgtcggcgtcatggccctcaac
atggaggacggcaccatccaccgtttccgctcgcacaagaccgtcctcgccacgggcgga
tacggcaaggcctacttctcggccaccagcgcccacacctgcaccggcgacggcatggcc
atggtctcgcgcgccggcctgccgctccaggacctcgagtttgtccagttccaccccacc
ggcatctacggcgccggatgcctcatcaccgagggctcccgcggcgagggcggatacctg
ctcaactcggagggcgagcgcttcatggagaggtatgcgcccaccgccaaggatctcgcc
tcgcgcgacgtcgtctcgcgctcgatgaccatcgagatccgcgagggccgcggcgtcggc
cccgagaaggaccacgtctacctgcagctctcgcacctgcccccggaggtcctccacgag
cgcctgcccggcatctcggagacggccgccatctttgccggcgtcgacgtcaccaaggag
cccatccccgtcctgcccacggtgcactacaacatgggcggcatccccaccaagtacacg
ggcgaggtcatcaccaagggccccaacggcgaggacaaggtggtgcccggcctctacgcc
gccggtgagacggcgtgcgtgtcggtgcacggcgccaaccgcctcggcgccaactcgctg
ctcgacattgtcgtctttggccgcgcgtgcgccaaccacatcaaggagaacctgtctcct
ggcaagccgcataaggagctcaagggcgacgcgggtgccaagtcgatcaacgacctcgac
tgggcgcgcaacgccaacggctccaagcccacggctcagatccgcaacgagatgcagcgc
gtcatgcagagcgacgccgccgtcttccgcacccagaagacgctcgacgagggtgtcgaa
aagatcgacaaggtgtttgacagctaccccgacgtcagcatccaggaccgctccatgatc
tggaactcggacctggtcgagacgctcgagctcaagaacctcctcacctgcgccacccag
acgatgcactcggccgccgcgcgaaaggagtcgcgaggcgcacacgcccgcgaggacttc
cccgaccgcgacgacgagacctggatgaagcacacgctgtcgtggcagcagggccagaac
gacaaggtcaagctcgactaccgcaacgtcgtcaacacgacgctcgacgaggccgagtgc
aagcccgtgcctccgttcaagcgacagtactag

DBGET integrated database retrieval system