KEGG   Anthracocystis flocculosa: PFL1_04319Help
Entry
PFL1_04319        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 19318424
NCBI-ProteinID: XP_007880036
UniProt: A0A061H502
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MALLASPSRGLDTAVSGDIAQQGGTDLTDRTTQREFRAYISAQIDRRFAGSRDVELPVLL
AESYLGAPSSRAPALTSASASASTSGARAKMDAKKDDVEQVMLMVRKLREGCVASGHLDA
FTLDVYELSVYLALLCLNIPQLASSLPRLVLDLYPAIPLETDTIPSPEGRNVMEDVEHIG
VDSRFAVGQAASSSPADLLVLRAHMASLLLLRSLCLSSHASRLGQYASAPAAAQGASLSS
SLKEYPALRQTVHASLDDQAKSIGLSALPDGATAALDVAEQVYRIVRDANVFQLHRLLSS
HGALTIWQRILVLQVVPTLREVAWRTVRRAYLHVPVSSHVAILANATTTSAPQTPSGVAA
ARRDGDWITRVLVLGADALPEPPAQDGTVGQPTRPAPRPRTQGHDVPDEWDADDPHDGAA
ADDDDELSTRLAATSLAAGAPGAIEGRRLLDFISSSSSSAAIASEEVRARVSETKDGTWI
LKVK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctggcaagtcccagccgcggtctcgataccgccgtctctggagacattgcg
cagcagggcgggacagacctcactgaccgcaccacacagagagagttccgggcctacatc
tcagctcagatcgacaggcggttcgcgggcagtcgggacgtcgaattgcccgtcctgctc
gccgagagctaccttggcgcgccgagcagccgtgcaccggcgttgacatcggcgtcggcg
tcggcatcgacgtcgggagcgagggccaaaatggacgccaaaaaggacgacgtggaacag
gtcatgctcatggtgcgcaagctcagggaaggctgcgtggcatccgggcacctagacgcc
ttcacactggatgtctacgagctgtccgtctatctcgccctgctctgtctcaacatcccg
cagctggcttcgagcctgccaagactggtcctggatctgtaccccgcgatacccctcgag
accgacacgataccatcgcccgaaggtcgaaacgtcatggaagacgtcgaacacatcgga
gtcgactctcgcttcgcggtcggccaggcagcgtcgtcctcgccagcggatctgctggtc
ctccgtgcccacatggcaagcctgctactcctacgctcgctgtgcctctcgagccacgct
agccgcctcgggcagtacgcctcggcgcccgcagcggcgcagggcgcatccctgtcctcg
tcgctcaaggagtaccccgccctgcgacagacagtccacgcatccctcgacgaccaggcc
aagtcgatcggcctttctgcgctgccagacggggcgacggcggcgctcgacgtggcagag
caagtctaccgcatcgtgcgcgacgccaacgtgttccagctgcatcgtctactgtcgtct
cacggcgcactgacgatctggcagcgcatcctcgtcctccaggtcgtccccaccttgagg
gaggtggcgtggcgcacggtacgtcgagcctacctccacgtccctgtgtcctcgcacgtg
gccatcctggcgaacgcaacgacgacctcggcgccgcagacgccgagcggtgttgcggcc
gcccgcagagacggcgactggatcacgagggtcctcgtgctcggcgcagacgccctacct
gaaccgccggcccaggacggcacggtcgggcagcccacgcggcctgcaccacggccacga
acgcaaggccacgacgtgcccgacgaatgggacgccgacgacccgcacgatggcgcggct
gccgacgacgacgacgagctcagcacgcggctggcagctacgagcctcgcggccggcgcc
cctggagccatcgagggccgacggttgttggactttatctcgtcctcctcgtcgtctgcg
gccatcgcgagcgaagaggtgcgggcgcgcgtgtcggagaccaaggacgggacctggatt
ctcaaggtcaagtga

DBGET integrated database retrieval system