KEGG   Anthracocystis flocculosa: PFL1_04368Help
Entry
PFL1_04368        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 RXT2_N FYDLN_acid BUD22
Motif
Other DBs
NCBI-GeneID: 19318473
NCBI-ProteinID: XP_007880085
UniProt: A0A061HBS9
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MSHAGSSTATATAAAASTAAPADLYDLTLRTHQIVERFLSSNGYDATAEQLRRDAAKAGL
EIPATSASTSYDPGLDLGTLVESYNSTLRAAQQRRLKASLDATHSSRSVVDPLTLTLPGP
SQLPFRLVSTHRTLHASNILSITRIPLPRRSFDTSARPPRFRNSSKPCIVTTAADKRIVF
SDAESGEVEEILEGDGDDVPGHRAAVLAVAQDPGNPRCLVSAGMDAKVVVWDLMTRKPVQ
SLSHHAKFAVRLAFSPSGEYLASAGYDRKIIVYRRRPVPAAAASRQGRAVDGSEAEEDED
EVDDDDDDNDDGDDDDDDDDEEHPSVGPDAFEKVFELETKTNPESIIFVRAAVQPSSGEV
QEIEARGGDEILVRHARRQRTWLAFTVRNDSFLHYLPLPLSADASGEGAGAAVEAGAQVD
GLTDQLAATELGEEPAETTRDWHLVSFNTNPNPEDLHVSYSLLSLSLDPSGLYICAQTGD
HTPTNLNTSSSSAATGPLSRLLLLPLLSSRRAGTVWTGIATSSYATPRHSWLPSGRGIWL
NSEDGVLRLVDLRGKVRAQVLCHGLVESTDAEAGSSAAAAVATTTTDEAQRVVSWSRGGN
TIIKDVVALDERSVASCGFDRTVRVLRLDADCAL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgctggcagctcgacggcgacggcgacggcggctgctgcatcgacagcggca
cctgccgatctgtacgacctgacgctgcggacgcaccagatcgtcgagcgcttcctgagc
tccaacggctacgacgccaccgccgagcagctgcgccgggatgcggccaaggccggcctc
gagatccccgccacctcggcctcgacgtcgtacgatccgggcctcgacctcggcacgctg
gtcgagtcgtacaactcgaccctccgcgccgcccagcagaggcgcctcaaggcctcgctc
gacgcgacccactcgtcgcgctccgtcgtggatccgctcaccctgacgctgccgggacct
tcgcagcttcccttccgtctggtctcgacgcatcgcacgctgcatgcctccaacatcctc
tccatcacccggatacccctgccccggcgcagcttcgacacctcggcccgcccgccccgc
ttccggaactcgtccaagccgtgcatcgtcaccaccgccgccgacaagcgcatcgtcttc
tcggacgcagagtccggcgaggtcgaagagatcctcgagggcgatggcgacgacgtgccc
ggacaccgggcggcggtgctggccgtcgcgcaggaccccgggaacccaaggtgcctcgtc
agcgccggaatggacgccaaggtcgtcgtgtgggacctgatgacgaggaagccggtgcag
tcgctcagccaccacgccaagtttgctgtccggctggccttcagcccctcgggcgagtac
ctcgcgtcggccggctacgaccgcaagattatcgtctaccgacgtcgccccgtgccagct
gcggccgcttctcgacaaggacgcgctgtcgatggatcagaggcggaggaggatgaggac
gaggtcgatgacgacgacgacgacaacgacgacggcgacgacgacgacgacgacgacgac
gaagagcacccgtcggtcggcccggacgcctttgaaaaggtgtttgagctcgagaccaag
accaacccggagtcgatcatctttgtccgcgccgcggtgcagccgtcgtctggcgaggtg
caggagatcgaggcgcggggcggagacgagatcctggtccgccacgctcgccgtcagcgc
acctggctcgcgttcacggtgcgcaacgacagcttcctgcactacctgccgctgcctctg
tctgcggatgccagcggagagggcgccggcgctgccgtcgaggctggcgctcaggttgac
gggctcaccgaccagctggccgccacagagcttggcgaagagcctgccgagacgacacgc
gactggcacctcgtcagcttcaacaccaacccgaacccggaggatctgcacgtcagctac
tcgctcctctccctgtcgctggatccgtcgggcctctacatctgcgctcagacgggcgac
cacacgccgaccaacctcaacacgtcgtcgtcgtcggcggccacgggtccgctgtcgcgg
ctgctgctgctgccgcttctctcgtctcggcgggcggggacggtgtggacggggatcgcg
acgtcctcgtacgcgacgccgcgccacagctggctgccgtcggggcggggcatctggctc
aactccgaggacggcgtgctgcgcctggtggacctccggggcaaggtgcgcgcccaggtg
ctgtgccacggcctcgtcgaatctaccgacgccgaagcgggctcatcggcggcggcagcg
gtggcgacgacgacgaccgacgaggcgcagagggtggtgtcgtggagccggggcggcaac
acgatcatcaaggacgtcgtggccctcgacgagcgcagcgtggccagctgcggcttcgat
cggacagtcagggtgctcaggctcgacgccgactgcgccctgtag

DBGET integrated database retrieval system