KEGG   Anthracocystis flocculosa: PFL1_04598Help
Entry
PFL1_04598        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp03030  DNA replication
pfp03410  Base excision repair
pfp03420  Nucleotide excision repair
pfp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PFL1_04598
   03410 Base excision repair
    PFL1_04598
   03420 Nucleotide excision repair
    PFL1_04598
   03430 Mismatch repair
    PFL1_04598
Enzymes [BR:pfp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PFL1_04598
    6.5.1.6  DNA ligase (ATP or NAD+)
     PFL1_04598
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PFL1_04598
DNA replication proteins [BR:pfp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PFL1_04598
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PFL1_04598
DNA repair and recombination proteins [BR:pfp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PFL1_04598
   NER (nucleotide excision repair)
    Other NER factors
     PFL1_04598
   MMR (mismatch exicision repair)
    Other MMR factors
     PFL1_04598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 19318699
NCBI-ProteinID: XP_007880315
UniProt: A0A061H5W6
LinkDB All DBs
Position
Unknown
AA seq 1127 aa AA seqDB search
MAPKKRPSSQPSTPSKKHKQNQSQSSLTSFFVSPSKKATAQAKTEQLGDHGAGSGPDKEP
SSNHASDLTQEEQDARFAAELAAAEDGVSPAEILRRMKADEDLARRLDLEWTQAKNEPES
SRSGEIGAGSTLRNDGDSPRKRRLVLEEHEDLDMYSSPRKVPKDTTTAIATPVSDLAHPK
PDPPAKPEPGKPIDLAALDAAIQAIPLGDDIFDFDPYAIDVSRWPRMAYGAGSQPLPTTP
YALLTHAFVQISATRSRLIITTLLTNLLRVIRAHDPDSLLPSVYLISNHIAPAYDGVELG
IGMSIVTKAIKEVTGKSARTLKSLWDKTGDPGDVAYEAKKDVKALVKPSPITVQKLFSTL
HAMARLSGSGSATQKLGYVTKLLVASRGEETRFLGRTFISHLRIQAVRTTIATALARVFA
LVEASGPRLEPATKREQERAALLLVHPEERQGILANATKPKERSDPRRLAVMDKLARAEK
LVREVRARHPNFGVIVPALLTVGLPGLSDHVPLRIGTPISPMLGSITRSLDAMHDKLGPR
AFVSEFKYDGQRCQIHAVYVPRSAGPEARKSIVESHNSAAASSGKCGKWVGRDGEVYVRL
FSRHLEEMTEKYPDISDMIPILMGRESEDEGNWAAPLGSKTGSAGVNAAEQENGKISEVA
DIDDGKPDGAEAASADVDDRPNDKVTSFIMDAEVVAMGLDGELLPFQTLANRSRKDVSLH
DIKVKVGVFAFDLMYLDGESLLKTSFRTRRNLLHSRFKPLAPRSPLIARFAHVRSCESTD
PDDVARFFAAAQQHKCEGIMVKSLDHHWETPASTTAAESGEEGGNGMPRGGRETPGDVDG
TGPDPGEGKRLEKLGDVIEDDLAVDQDGVDDGEEGGTTTTATSATTSSSVDLGASAIGKG
VNGRGKALLSTYEPDKRCESWLKVKKDYVDGLGDSLDLVPIGAWHGMGRKATWWSPILLA
VYDADTGVFQAVCKCISGFTDAFYKDLNVRYAEGSDTCVRARHGEPPPGGYEYDTGSLVP
DVWWRPSEVWELRGADITLSPNYTAALGLVSEERGLSIRFPRFIKRRDDKGVEQASSPHQ
LAAIYRDQQRAGPKAAVDDNVEDEDGDREEAAVATKVAAPVDIDFEY
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaagaagcgtccatcaagccagccctcgacaccatccaagaagcacaagcag
aaccagagccagtcgtccctcacctccttcttcgtatcgccctccaagaaggcgaccgca
caggccaagacggaacagctcggcgaccacggcgctgggtccggccctgacaaggagcca
tcctcaaaccacgcatccgacctcacccaagaggagcaggatgcgcgcttcgccgccgag
ctcgctgccgccgaagacggcgtcagccccgcagagatactccgccgaatgaaggccgac
gaggaccttgcacggcggctcgacctagaatggacccaggccaagaacgagcccgagtcg
tcgcggagcggcgagataggtgccggctcgacgctgcggaacgacggcgactcccctcgc
aagcgtcgcctcgtcctcgaggagcacgaggacctcgacatgtacagctcccccagaaaa
gtgcccaaggacacgaccactgccatcgccacgcctgtctccgacctggcgcatccgaag
cctgatccacccgccaagccggagcccggcaagccgatagacctcgccgctctcgacgca
gccatccaggcgatcccgctcggcgacgacatcttcgacttcgacccctacgccatcgac
gtatccagatggccccgcatggcgtacggcgccggctcgcagcccctgccgacgacgccc
tacgcgctgctgacgcacgcctttgtccagatcagcgccacgcgctcgaggctcatcatc
acgaccctcctcaccaacctgctgcgcgtgatccgcgcccatgacccggacagcctgctc
ccctcggtctacctgatctccaaccacatcgcgccggcctatgacggcgtcgagctcggc
atcggcatgtcgatcgtcacaaaggccatcaaggaggtgacgggcaagagcgcgcgcacg
ctcaagagcctgtgggacaagacgggcgacccgggcgacgtggcctacgaggccaaaaag
gacgtcaaggcgctcgtcaagccgagcccgatcacggtgcagaagctcttctcgacgctc
cacgccatggcccggctctctggctcgggctcggcgacgcagaagctcggctacgtcacc
aagctgctcgtcgcgagccgcggcgaggagacgcgcttcctcgggcgcacctttatctcg
cacctgcgcatccaggcggtgcgcaccacgatcgccaccgccctcgcgcgggtgtttgcg
ctggtcgaagcgtccgggccgcggctggagccggcgaccaagcgcgagcaggagcgagcg
gcgttgctgctcgtccatccggaggagcgacagggcattctggccaatgcgaccaagcca
aaggagcggtcagacccgaggcggctggccgtcatggacaagctggcccgagccgagaag
ctggttcgcgaggtacgcgcccggcatcccaactttggtgtcattgtgccggccctgctc
acggtcggcctcccgggcctgtcggaccacgttccgctgcggataggaacgccgatctcg
cccatgctcggatccatcacgcgctcgctcgacgcgatgcacgacaagctgggcccgcgc
gcctttgtgtccgagttcaagtacgacggccagcggtgccagatccacgccgtgtacgtg
ccccgctcagccggccctgaggcgcgcaagagcatcgtcgagtcgcacaacagcgccgcg
gcgagcagcggcaagtgcggcaagtgggtcggcagagacggcgaggtgtacgtgcgcctg
ttttcgcgccacctcgaggagatgacggaaaagtacccggacatcagcgacatgatcccg
atcctgatggggcgcgagtcggaggacgagggcaactgggccgcaccgttggggagcaag
accggcagcgcgggcgtcaacgcggccgagcaggagaacggcaagatcagcgaggtcgcg
gacatcgacgacggcaaacctgacggcgccgaagccgcatcggccgacgtcgatgatcgc
ccgaatgacaaggttacctcgttcatcatggacgccgaggtagtggccatgggcctcgat
ggcgagctgctgcccttccagacgctggccaaccgcagccgcaaggacgtcagcctgcac
gacatcaaggtcaaggtgggcgtgtttgcgttcgacctcatgtacctcgacggcgagtcg
ctgctcaagacgtcgttccgcacgcgccgcaacctgctccactcgcgcttcaagccgctc
gcgccccgcagcccgctcatcgcccgcttcgcccacgtgcggtcgtgcgagagcacggat
ccggacgacgtggcgcggttcttcgccgcggcgcagcagcacaagtgcgagggcatcatg
gtcaagagcctcgaccaccactgggagacgccagcgtcgacgaccgccgctgagtccggc
gaagaaggtggaaatggcatgccccgaggcgggcgtgaaacccctggcgatgtggacggg
accgggcccgatcctggtgaaggaaagcgcctcgagaagctcggcgacgtcatcgaggac
gaccttgccgtcgatcaggacggcgtcgatgacggcgaggaaggcggcacaacgacgacg
gcaacttcggcgacgacgtcgtcctccgtcgacctcggcgcgtcggcgatcggcaaaggt
gtcaatggccgcggcaaggcgctgctctcgacgtacgagcccgacaagcgatgcgagtct
tggctcaaggtcaaaaaggactacgtcgatggcctcggcgactcgctcgacctggtcccg
atcggcgcctggcacggcatgggccgcaaggcgacgtggtggtcgcccatcctgctggcc
gtctacgacgccgacacgggcgtcttccaggcggtgtgcaagtgcatctccgggttcacc
gacgccttctacaaggatctcaacgtgcggtacgctgagggcagcgacacttgcgtccgg
gcgcgccacggcgagcccccaccgggcgggtacgagtacgacacgggcagcctggtgccc
gacgtgtggtggaggccgagcgaggtgtgggagctacgcggcgccgacatcaccctcagc
cccaactacacggccgcgctgggcctggtgagcgaggagcgcggcctgtcgatccgcttc
ccgcgcttcatcaagcggcgcgacgacaagggcgtcgagcaggcctcgtcgccccaccag
ctcgcagccatctaccgcgaccaacagcgggcaggcccaaaggccgcagtagacgacaac
gtcgaggacgaggacggcgaccgagaagaggcggccgtggcgacaaaggtcgcggcaccg
gtcgatatcgactttgagtactga

DBGET integrated database retrieval system