KEGG   Anthracocystis flocculosa: PFL1_05080Help
Entry
PFL1_05080        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K14807  ATP-dependent RNA helicase DDX51/DBP6 [EC:3.6.4.13]
Organism
pfp  Anthracocystis flocculosa
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfp03009]
    PFL1_05080
Enzymes [BR:pfp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PFL1_05080
Ribosome biogenesis [BR:pfp03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    PFL1_05080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII BUD22 AAA_19 SWI2_SNF2 CNDH2_C AAA_22 NOA36 TFIIA Nop25
Motif
Other DBs
NCBI-GeneID: 19319179
NCBI-ProteinID: XP_007880800
UniProt: A0A061H3Y9
LinkDB All DBs
Position
Unknown
AA seq 786 aa AA seqDB search
MSSRASSDTPALKKRKLDAPGGEASVTAEPPTRASNLNIHPSRLGRAPALKAAVKPSIGG
SKEKTKAKQRYLKAKKDRKKARRKAAPKGEKKKQKPTSLAAIGDSLTFPEEAALHAAAAE
TQSALDPVPESDSSSESSSDNDDDDDNDDDNDDDDDDDDDDDDDDDNDNDNDDDNTSGAA
NTSAGVRMRDADGDSPEDTGSATQEVENTNGRLNEDHEEVVGLQRFPAAGIKKASDPALI
KQLGLTEGMSSRTVVDPKLSTPLISATTGATPTSQGAIVVVENASKESGGFANVALSESV
RSRLEELGVSEWFAVQVSVIPSLLLLPHSRSLYRPTAPPRDLCVSAPTGSGKTLAYAVPI
VEILRTRQVTRLRALIVLPTRDLVSQVKSTIELISKGTGLKVGIATGHHSFSHEQSQIMN
RDFNRPKVDILISTPGRLIDHLDSTLGFTLSHLRFLVIDEADRLLSQSFQEWLRKVLQAT
EEDPSAIAAESDSFRDLDERLGVGSLEGPPAEAPSRVLRHHHGAPDDVLEQVKPAVQKLL
FSATLTRDPAKIAALGLRHPHYIAIQAEPTDDDRPSHESFSLPQSLREHMLVTSAADKPL
ELLQLLHRPKSPLRRVLCFTKSVESAARLVKLVEFFEQAQTARGLPAITAENFSSELKAG
RRQKIMDEFAKGQIDLLVCSDLISRGIDLPDVQHVISYDVPVDASKYVHRVGRTARANRE
GDAWTLVEEHEARYFKGLLKAVIRQGKVEKIKPTADSVDPRMRDDYAAALQKLADFYKRS
GSEAGR
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcgggcctcttcagatacgccggccctcaagaagcgcaagctcgatgcgccc
ggcggtgaggcttcagtcactgcagagccgccaacgagggcctccaacctcaacatccat
ccgtcgcgactcggccgcgcccccgccctcaaagccgccgtcaagcccagcataggaggc
tcaaaggaaaagaccaaggccaagcaacgctacctcaaagccaaaaaggaccgcaaaaag
gcgcgcaggaaggcagcgcccaagggcgaaaagaagaagcagaaacccacttcgctggcc
gccatcggtgattcgctgacttttccagaggaagcggcgcttcatgcggctgctgcagag
acgcagagcgccttggatccggtccctgaatctgattcgtcctcagagagcagcagcgac
aacgacgacgacgacgacaacgacgacgacaacgacgacgacgacgacgacgacgacgac
gatgacgacgacgacgacaacgacaacgacaacgacgacgacaacacctcgggtgcagcg
aacacttccgccggcgtcagaatgagagacgctgacggcgactctccagaagacacaggt
tcagcgacgcaagaggttgaaaacaccaatggaaggctgaacgaagatcatgaagaggtg
gttgggcttcaacgcttcccggccgccggtatcaagaaagcctcggatcccgctctcatc
aagcagctcgggctcaccgagggcatgtcgagccggaccgtcgtcgatccgaaactctca
acgccgctcatctcagcgaccacgggtgcgacgccaactagccagggtgcgatcgttgtc
gtggagaatgcgagcaaggagagcggcgggtttgccaatgtggcgctcagcgagagcgtc
cgcagccgtctcgaggagctgggcgtgtcagagtggtttgcagtccaagtctccgtgatc
ccatcgttgctcttgctgccgcacagcaggtcactctaccgacccacggcgccgcctcga
gacctctgcgtgtcggcgccgaccggcagcggcaagacgctagcctacgctgtgcccatc
gtcgagattctgcgcacgcggcaggtgacgagactccgcgcactgattgtgctgccgacc
cgcgacctcgtgtcgcaggtcaaaagcaccattgagctcatctccaagggcacaggtctc
aaggtcggcattgccaccggtcaccacagcttttcgcacgagcagtcgcagatcatgaac
cgggacttcaaccggcccaaagtcgatattctgatctccacaccaggaaggctgatcgac
caccttgactccaccctgggattcacgctgagtcatctgcgcttcctcgtcatcgacgag
gccgatcgtctcctcagccagtcgtttcaggagtggctgcgcaaggttctgcaggccacc
gaggaggatccctccgcaatcgctgccgagtcagactcgttccgcgacctcgacgaacgc
cttggcgtcggaagcttggaaggcccccccgcggaggctccttcccgcgttttgcgccac
catcatggtgcgcccgatgatgtgctagagcaagtcaagcccgcggtccagaagctgctg
ttctccgccacgctgaccagggaccctgcaaagatcgccgcgctgggacttcgacatccg
cactacatcgccatccaggcggagcctacagacgacgatcgacccagccacgagagtttt
tcgctgccgcagtctctgcgagagcacatgttggtcaccagcgccgcagacaagccgctc
gagctgctccagctcctgcatcggccgaagtctccgctgaggagagtgctctgcttcacg
aaaagcgtcgagtcagcggcaaggctcgtcaagctcgttgaattctttgagcaagcgcag
acggcccgcggccttccagccatcacggcggaaaacttctcgtccgagctcaaggcgggc
aggaggcaaaagatcatggacgaattcgcaaagggtcagatcgatctactggtctgctcc
gacctcatctctcgcggcattgatctgcccgacgtgcagcacgtcatttcgtacgacgtg
cccgtcgacgcctccaagtatgtccaccgggtcggtcggactgcgcgagccaatcgtgaa
ggagatgcctggaccctggtcgaggagcacgaggcgcgctatttcaagggccttctcaag
gccgtcatccgacagggcaaggtggagaagatcaagccgacggcggacagtgtcgatcct
cggatgcgggatgattacgccgcggcactccagaagctcgccgacttctacaagcgctcc
ggatcagaggcgggccgttaa

DBGET integrated database retrieval system