KEGG   Anthracocystis flocculosa: PFL1_05694Help
Entry
PFL1_05694        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K12863  protein CWC15
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PFL1_05694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pfp03041]
    PFL1_05694
Spliceosome [BR:pfp03041]
 Complex B
  Other components
   Prp19 complex
    PFL1_05694
 Complex C
   Prp19-CDC5 complex
    PFL1_05694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cwf_Cwc_15 BUD22 Nop14
Motif
Other DBs
NCBI-GeneID: 19319780
NCBI-ProteinID: XP_007881420
UniProt: A0A061H457
LinkDB All DBs
Position
Unknown
AA seq 315 aa AA seqDB search
MSTAHRPTWEAQKAKADSAHLSAQTVKAYVPAHTRLKFRQPAQSADIRSIQTNPERRRDL
KRELEAAEREAKNKKRIAQGLPPLEDDSTAGGHAAGQEEEEEESVKRRKLIEQARELDRD
DDDDDGDDDEEGGGKGDARAAGHGAANGKVKVNGTDDADGQGGPAAAASDAGSSSDSDDS
DDSDDGDDEEDDTAALLRELEKIKRERAEEKARQEQERQNAERSQREDEIALGNPLLNLE
NAMKAGSASPSVANGGGGGGAGGKRGFGVKRRWDDDVIFKNQASGAANRDGGSGGFVNDL
TRSEFHKKFMNRYIK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcgcaccgtcccacctgggaggcgcaaaaagccaaggccgactcggcccac
ctctcagcgcagaccgtcaaggcctacgtcccggcacacacccgcctcaagttccggcaa
cccgcccagtccgcagatatccgcagcatccagaccaacccggagcggcggagggacctc
aagcgcgagctcgaggcggccgagagggaggccaaaaacaagaagaggatagcccagggc
ctgccgccgctcgaggacgactccacggcaggggggcacgcagctgggcaggaggaggag
gaggaggagagtgtcaagaggcggaagctgattgagcaggcgcgagagctggatcgagac
gatgacgacgatgatggcgatgacgacgaggagggcggaggcaagggcgacgccagggca
gcaggacacggcgcagccaacggcaaggtcaaggtcaacggcaccgacgacgccgacggg
caaggagggccagctgccgctgcatccgacgccggctcttcatccgactcggacgactcg
gacgactcagacgacggcgacgatgaagaggacgatacggcggcgctgctgcgcgagctg
gaaaagatcaagcgggagcgcgccgaggaaaaggcgaggcaggagcaggaacgccaaaat
gccgagcggtcgcagcgcgaagacgagatcgcactgggcaacccgctcctcaacctcgaa
aacgccatgaaggccggttccgcctctccctcggtcgccaacggcggtggcggtggcggt
gcgggtggcaagcgtgggttcggtgtcaagaggaggtgggacgacgatgtcatcttcaag
aaccaggctagcggcgcggctaaccgcgacggcggatctggcggcttcgtcaacgacctg
acccgttccgagttccacaagaagttcatgaaccgctacatcaagtga

DBGET integrated database retrieval system