KEGG   Anthracocystis flocculosa: PFL1_06369Help
Entry
PFL1_06369        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00040  Pentose and glucuronate interconversions
pfp00051  Fructose and mannose metabolism
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFL1_06369
   00051 Fructose and mannose metabolism
    PFL1_06369
Enzymes [BR:pfp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     PFL1_06369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PrmA ADH_zinc_N_2 MTS Methyltransf_25 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 19320447
NCBI-ProteinID: XP_007882101
UniProt: A0A061H6D0
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MAPTALSTPTPAQPSTSAIPAKANNTMTTNLSAVLHGPKDLRVVSRPIEAPAPTEVQIRV
RCTGLCGSDLHYYIHGRNGDFALQHPMCLGHESGGEIVALGADVAASQALSIGDRVAIEA
GRMCGACQKCKEGRYNLCKNMRFASSAKTFPHLDGTLQRFMNWPAALVHRLPENVSYTSA
ALCEPLSVVLQGIRRSNLQAGQSVLVLGAGAVGLLACAAAKASGASYVAAADIDEGRLAF
ARANAAKSGASVLLETLSSPSSTAATAGQDGGYAVNAAPLDLSTDGFDLTFECTGVPSCV
SLSIFTTRAGGKTILIGMGNPIQTLPIGAAALREVDIVGVFRYANTYPVALGLLAGGGLR
AVGGGVHASGSTVDGATEGHGVGRKMGGIENLVSHSFPLEQSVEAFETLARGKGAEGRGV
VKVFVVDNEP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcacccactgctctatccacgcccaccccagcccagccttccacctccgccatcccc
gcaaaggccaacaacaccatgacgaccaacctcagcgccgtcctccacggcccaaaggac
ctccgcgtcgtctcgcgccccatcgaggcccccgcacccaccgaggtccagatccgcgtg
cgctgcaccggcctctgcggctccgacctccactactacatccacggccgcaacggcgac
tttgccctccagcacccaatgtgcctcggccacgagtccggcggcgagattgtcgccctc
ggcgcagacgtcgccgcctcccaggccctctccatcggcgaccgcgtcgccatcgaggca
ggcaggatgtgcggcgcctgccaaaagtgcaaggagggcaggtacaacctctgcaaaaac
atgcgcttcgccagcagcgcaaagaccttcccccatctcgacggcaccctccagaggttc
atgaactggcccgccgccctcgtccacaggcttccggaaaacgtgtcgtacacctcggca
gcgctctgtgagccgctgtcggtcgtgctccagggcattcgacggtccaacctgcaggcg
ggccagtcggtcctcgtcctcggtgcaggcgccgtcggcctgctcgcctgcgcagccgca
aaggcctcgggagcgtcctacgtcgccgccgccgacatcgacgagggccgcctcgccttt
gcgcgcgccaacgccgccaagtcgggcgccagcgtgctcctcgagacactctcttcgccg
tcctcgacggccgccaccgccggtcaggatggcgggtacgcggtcaacgctgcgccgctc
gacctgagcaccgacggcttcgacctgacgtttgagtgcacgggcgtgccgtcgtgcgta
tcgctgagcatctttaccacgcgggcgggcggcaagacgattctgattgggatgggcaat
ccgatccagacgctgcccattggcgcggcggcgctgcgcgaagtcgacatcgtcggcgta
ttccgatacgccaacacctaccccgtcgcgctgggtctgcttgccggtggcggtctgcgc
gccgtgggagggggtgtacacgcttcggggtccacggtggatggtgcgaccgagggacac
ggcgtggggaggaagatgggcgggatcgagaacctcgtctcgcactcgtttcccctcgaa
cagtccgtcgaggcctttgagacgcttgcccgcggaaagggggcagagggacgcggtgtc
gtcaaagtctttgtggtcgacaacgaaccctag

DBGET integrated database retrieval system