KEGG   Anthracocystis flocculosa: PFL1_06520Help
Entry
PFL1_06520        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00250  Alanine, aspartate and glutamate metabolism
pfp00410  beta-Alanine metabolism
pfp00430  Taurine and hypotaurine metabolism
pfp00650  Butanoate metabolism
pfp01100  Metabolic pathways
pfp01110  Biosynthesis of secondary metabolites
Module
pfp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFL1_06520
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PFL1_06520
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFL1_06520
   00430 Taurine and hypotaurine metabolism
    PFL1_06520
Enzymes [BR:pfp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PFL1_06520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 19320595
NCBI-ProteinID: XP_007882256
UniProt: A0A061H236
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MTLSATSHAAASPAKQSLSPLESEPASTELDRILPQAVELVKQFVRSGQDPETFVTPWPS
IAALRQNVQLDLPDVAAAPRGGEATDAALLDAIRLILDNSVNPWTGRFLDKLYSAPTPVG
ICADLVLSTLNANAHVMSASPMLSLAEERCVEGLCRVFGFTETKPDGLTMPGGSSANTLA
VQTALANIFPPFREQGLLGVAAYLAEKHGRTGSAARPLIFTSDQSHYSLDKAAISAGLGL
SSIVKVPCDETGRMDPEALSRLLESAVSSGSGSPFFINATSGSTVLGSFDPIPALSALAK
RYGCWLHIDGSWGGPIIFSPTEAFASQMAGSHLADSITINPHKLLNVPLQCSFLLVRDAA
SLGANSLDAGYLFHSKDARENAAMKTMGCGRRGDAVKLWLYWVRYGKRGLGEHVDAGLAL
AQRVVDYIRTEKAETMELGPLASPLFLQVCFRPKPRPGQGRGEASIEQRSAATRHTHREL
QQRRRFAVDFAPLPRGIGEFVRLVVHPRTKWHDLQELIDQVDDIGQAYWSQASV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacgctatccgccacgtcccacgccgccgcctctccggcaaagcagagcctgtctccg
ctcgagagcgaacccgcctcgactgagctcgaccgcatcctcccgcaagccgtcgagctc
gtaaagcaatttgtccgctccgggcaggacccagagacgtttgtcacgccctggccctcg
attgccgcgctgcgccaaaatgtgcagctcgacctgccggacgtcgccgccgccccgcgc
ggtggcgaggccaccgatgcggcgctcctcgacgccatccgcctcatcctcgacaacagc
gtcaacccgtggaccggacgcttcctcgacaagctctactcggcgcctacccccgtcggc
atctgcgccgacctcgtcctctcgacgctcaacgccaacgcccacgtcatgtccgcatcg
cccatgctctctctcgccgaggagcgctgcgtagagggcctctgccgcgtgtttggcttc
acagagaccaagcccgatggcctcaccatgcccggaggctcctcggccaacaccctcgcc
gtgcagaccgcgctggccaacatcttcccgcctttccgcgagcagggcctcctcggcgtc
gcagcctacctcgccgaaaagcacggccggacgggcagcgccgcccgcccgctcatcttc
accagcgaccagagccactacagcctggacaaggctgccatctcggccgggctgggcctc
tcgtcgattgtcaaggtgccctgcgacgagacggggcgcatggatcccgaggccctgtcg
cgcctcctcgagtcggccgtgtcgagcgggtccggctcgccctttttcatcaacgccacc
tcgggctcgacggtgctgggctcgtttgaccccatccccgccctctcggcgctggccaag
cggtacggctgctggctccacatcgacggctcgtggggcgggcccatcatctttagcccg
accgaggcctttgcgtcgcagatggccggctcgcacctggccgattcgatcaccatcaac
ccgcacaagctgctcaacgtgccgctgcagtgctcgttcctgctggtgcgcgacgccgcc
agcctcggcgccaactcgctcgacgccggctacctcttccacagcaaggacgcacgcgaa
aacgccgccatgaagacgatgggctgcggccggcgcggcgacgccgtcaagctctggctc
tactgggtgcgctacggcaagcgcgggctgggcgagcacgtcgatgccggcctggcgctg
gcccagcgtgtcgtcgactacatccgcaccgaaaaggccgagaccatggagctgggcccg
ctggcctcgcccctatttctgcaggtctgcttccgacccaagcccaggccggggcagggg
cggggggaggcgagcatcgagcagaggtcggcggcgacgcggcacacgcaccgcgagctg
cagcagcggcggaggttcgccgtcgactttgcgccgctcccgcgcggcattggcgagttt
gtccgcctcgtcgtccacccgcgcacaaagtggcacgacctccaggagctcatcgaccag
gtcgacgacatcggccaggcctactggagccaggcgagcgtctag

DBGET integrated database retrieval system