KEGG   Anthracocystis flocculosa: PFL1_06708Help
Entry
PFL1_06708        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PFL1_06708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfp01001]
    PFL1_06708
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pfp03032]
    PFL1_06708
   03400 DNA repair and recombination proteins [BR:pfp03400]
    PFL1_06708
Enzymes [BR:pfp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PFL1_06708
Protein kinases [BR:pfp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   PFL1_06708
DNA replication proteins [BR:pfp03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     PFL1_06708
DNA repair and recombination proteins [BR:pfp03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    PFL1_06708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC
Motif
Other DBs
NCBI-GeneID: 19320779
NCBI-ProteinID: XP_007882445
UniProt: A0A061H0Z0
LinkDB All DBs
Position
Unknown
AA seq 3182 aa AA seqDB search
MVVSLQDTLEQLRSERVKDRQNALANLDQIFADPANVANLDPRGDGKPWLKTFQSLFACV
VIERATCLKKGSIASAQPIALSRLRDAAYALRQLVERSVRHLNRRAIKAILSHIVQMFVH
NGAVFQPVSMSYLKALSTILQFPPHVDHLEVDEWSMVAQLCSNVVLGDDPDTPLAQHTPP
AQPTNRPLGLEDVEHMVCLHHLVASPTAPLRGDDSCGLSLLDRYAAFLERHPVETSSHLP
ALAGLNRLLRELELNEALDVIRFSSRASRTLLALWHTKNRQLKEQLVICWRILVPVVSSC
LSPTYECPAAEKATLPAVQDDARMTLVDLHRSILREHESRSGSRPITLTSLRLKPSEPAD
RRRPYELLTLRQGAAFSESDALAWAILELNATALIGLLPPPPEQLQLQLRRSAATQDPSS
REPSVVHDTDELPPTTATQSPTKRRRTTPDAPSSTKRRRAGTGVVLSKTGSALIGALLSD
LRRSTSLRTGSKGQDSLLWQLQLVLFVIDRWPELDAAVRRGLTETVLGLASNADAVIQSW
AFVCLAEVARHCPADRQPEESHDQASDDTTVAAGVDAALAQAWTLACRRLPSAPVTRPAA
HLLSTLLRSSRMPEATVLADLRSILAEIHALGPSVLCDSSSDFLVAALDRASRDAQLFSL
NLRPKVLDWLLVIWRTGVVLAMRHVPPRSSDLEWTDLLALLSACVDHAAPGLAYSAFNAH
TRHTDLTASIADEKELDSLRNFLLFQRVQSDRRPSGSTTSPLPDEAKVTPPGDASGESTP
QLSPMNTEQRRICNALERGVLCANALLMPSGADAAASMMPSASSEKSLAKSLEPEQAATL
LDLALLALAFHAVLAERRIAALGAMASAAAKLLNHTVNLVLGRHDWTPAERLSVLQALAP
LLPLPLADSASPTSSDVLLVQPGPRAGVRNAGSSKKRSAQMPALSAAAKQALATGFWRTL
LSAQGLKPLLESLYNSVHHDLTDGTVDASQPASLNASLSRGESSGGDVRATIDDDDNDDD
FIGTARMASHDTSRSQREQGAAKGYSQDLIALCVAALVQAPKLAAGSDEPTQDERLVNLM
FEGSLDSLVKLGPSLVAAVSSGCLWLTLRDVIDLLDQIGSDLLTSYHFARDQRARCLAID
LVSATMPMWLGGKRLTTELLDKLRKLCVFFTEQVTKQKWRSPWKTRRRAAEFIADYIQAD
PQERLWINDDEELISRCPPSEAALHLNCDADVRVRASGATITAGLFDHLDRDDDGFAALY
EKLKERLPLDHAKRENVATRVLCLSNVTISSSSLRNVSLFHLLEIFLATGSLEPTLRRAF
EEIAARLGFAGPRQLFKCFAGQITWGMVGNSYDPLKVPYKILGFRSRKECIEQTFRESGA
MLLASDQGSGRDYFATMARTARKTVKEGIRECLPFLAASELGFAAEEAQGAPTSSRAALW
ARVLDTIKQWDPDVGADVDAAQMLQLVTSIADQVVTALLAMFYEPASSTAFPESLRIKDE
ATHRNLIFIAPTIGSQDRRIAAHEPNRPFFAATTVHEAILVLAESGVDPTGTEVAYHVLR
QTFFRIGNAPFVNDQRRYVQAVQLYVAMCAEGVSSSPRLLDVLLQGIGFLVDQPSVHEAA
LSLASWAISACAKQDWLQARVASILTEFARTAAFGPDEGPAEIMDTARATSSTCRWAETT
IAALPPASEAVRLALHMWPNEIPPQLKSLAPADARPRDIAAALQRCPDVRVTAAVLNRLR
VSLKAASAEERQAFARSTVWLLFERLRLDELQGQRIDELAQMGQALSEMLNICEGRLQTP
GLGAMQSLPSSEVHAALESTMSLKNPSRALQAVTIFIVLQHLRGRSITPAEQAYVALRGI
LSLAKTLTAALPKWPNQAYEELTFLAAFEAPEPSAPTRSARELEDPTLVASATAFEVWIR
KITGIISHMLIKSSTSTFFHHIQGLVEGEAEIASRVLPVLLQLCTADESCEGGDEVIRHL
DASREAIARHFREVLTSDGSDPRAWSAIIEGLLHVRRWSVLESDPTSSDLWFDIDFLLLA
RRGLDCKMYTAALLFVELYFEHSTDASDAEAKQGAISSLLYDAYSNVEDPDGFYGVVNAD
IQESLTRRLHHEGEWHRALQLHAAAYEASATLLKSAGKGIGQLVAKDFHMLGFNRLASML
QGPATPASSAPVLGAAGPQYGGFQYDMAWRMGSWDLPCSDPYVAGTSRGTYAALKALHRD
RSGASIDRAVAGGFARELEGLAGAKPEAINDVRKVQLDLLSLHEVREWRQLASQLGAEEA
VAHLTAFWAEPRPTFHIECHERVLSVRQSILQAERTRGQLHEIGNLLSPAAEESMRLERS
MMICLSAAARKQGRIQVSINATSEAQRLQAALSDKSNLTDEEFASVLWAQGEHAFALESL
GAIIEAFQVGEKSAVRSRYRKAVLMARLGEWRATARSQQPRAIDTTLFKPALELMVAQSS
GHAQSTEEQAKVAYKWAKFADEQYRGVDAEEIERLKVYIDRRKEEIRQNQVESDRTVSRS
LKQRLMQFQRQAEKILRQDENHLKELESARTLFLQRAIAMYSRSLTMSDRYDDAVGRLTS
LWFDNAFDENANRPLSATLPQIPSHKFIPLTHQLSARLSTAKGSAGKGLSTFQTNLSDLV
LRVCRDHPFHTLYALFALLKAGKDAKASERRDVSASQGAESSQRQRSMAAESIWVRVRTT
DRLRRRLQVFDEVCQAYVEWAEVNLAQQFSRYFTPNGAIKRGPLRMPPASELRLVRLRDV
DVPVATAEVPIDRSCEYRDIVSIVRYSETFTTAGGIHLPKINECIGSDGKRYKQLFKRDD
DLRQDAVMQQVFRLVNGLLDRDRKASQRRLTVRTYAVIPLGPQCGLLEFVTNTVPIGEVL
IRMHGQYGPKDMSPMEARTRIREAQGLTASQKLEVFLDVCERMPPAFRFFFTERQKDPPS
WFAMRLNYTRSAATTSIVGHILGLGDRHVSNILLDKQSGELVHIDFGVAFDQGKLLPIPE
LVPFRLTRDLVDGMGLSGIEGTYRRCCEETLRVLRDGRDVVKTVLEVFKHDPLFVWTSNP
IKVLKAQGAAGGGGDDDDDETNGGGGDESAVGMGARGRGRRSDHGRGAAPSVEPTPPPPP
NPSATSLMTIDTAELSADRAITSVMTKLSSSLSVEYTVNELIQQAMDAGNLSAIFQGWQA
AL
NT seq 9549 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtctccctccaagacaccctcgagcagctccgctccgaaagggtaaaggaccgc
cagaatgcactcgcaaacctcgatcagatcttcgccgacccagccaacgtcgcaaacctc
gatccgcgcggcgacggaaagccctggctaaagaccttccagtccctctttgcctgcgtc
gtcatcgaaagggccacctgcctcaaaaagggctccatcgccagcgcccagcccatcgcc
ctctcgcgcctccgcgacgccgcatacgcccttcgccagctcgtcgagcgctccgtacgc
catctcaaccgcagggccatcaaggccatcctctcgcacatcgtgcagatgtttgtccac
aacggcgccgtcttccagcccgtctccatgtcctacctaaaggccctctcgaccatcctc
cagttcccaccccacgtcgaccacctcgaggtcgacgagtggtccatggtcgcacagcta
tgctccaacgtcgtcctcggcgacgaccccgacacgcccctcgcccagcacacgcccccc
gcccagcccactaaccgcccgctcggcctcgaagacgtcgagcacatggtctgcctccac
cacctcgtcgcgtcgcccaccgcacctttgcgcggcgacgacagctgcggcctcagcctc
ttggaccgctacgccgccttcctcgaacgccacccggtcgagacctcgagccacctgccc
gccctcgccggactcaacaggctgctcagggagctcgagctcaacgaggccctagacgtc
atccgcttctcgagccgcgcatccaggaccctcttggcgctctggcacaccaagaatcgc
cagctcaaggagcagctcgtcatctgctggcgcatcctcgttcccgtcgtgtcgagctgc
ctgagccccacctatgaatgccccgcggccgagaaggccacgctgcctgcagtccaagac
gatgcccgcatgacgctcgtcgacctgcaccgctccattctccgcgagcacgagagtcga
tccgggtcgcggcccatcacgttgaccagcctcaggctcaaaccttcggaacctgccgat
cgacgaaggccctacgagctcctcacgctgcgacagggtgctgccttctccgagtcggat
gccctggcgtgggccatcctcgagctcaacgcgaccgccttgatcgggctgctgccgccg
cctccggaacagctgcagctgcagcttcggcgaagcgccgcgacccaggacccaagctcg
cgcgagccctcggtggtgcacgacacggacgagttgcctccgacgacggcgactcagtct
ccgaccaaacgcagacggaccacgccagacgccccatcttcgacaaagaggcgacgagct
gggaccggcgtggtcctgagcaagaccggatcggccctgatcggcgcgctcttgagcgac
ctgaggcggtcgacgtcgctgcgcaccggaagcaagggccaagattccctgctctggcag
ctgcagctcgtcctctttgtcatcgaccgctggccggagctggacgcggcagtccgcaga
ggcctgaccgagaccgtcttgggccttgccagcaacgcggacgcagtgatccagtcctgg
gcatttgtctgccttgccgaggttgcccggcactgtcctgcggatcgacagcccgaagag
agccacgatcaagcatcggacgacaccaccgtcgccgccggcgttgatgccgccttggcg
caggcgtggacgctggcctgccgacgcttgccatcggctcccgtgacgcgtccggccgct
cacctgctctcgacgctgcttcgctcgtcaaggatgccggaagcgacggtgctggcggac
ctgcgctccatcctcgccgagatccacgcccttgggccttcggtgctgtgcgactcgagc
tcagactttctcgtggcggctctggatcgggctagcagagacgcgcagctcttctcgctc
aatctccgcccaaaggtgctggactggcttctggtcatctggcggacgggcgtcgtgctc
gccatgaggcacgtgccgccgcggagctccgacctcgagtggacggatctgcttgcactc
ctctcggcctgcgtcgaccacgccgccccgggcctcgcctactcggcgttcaacgcgcac
accaggcatacggacctcacggccagcatcgccgacgaaaaggagctcgacagcctgcgc
aactttctgcttttccagagggtgcagtcggatcgacgcccatcaggcagcacgacgtcg
ccgttgcccgacgaggcgaaggtcacgcctcccggggacgcgtcgggagaatcgacaccg
cagctgtcgccgatgaacaccgagcagcgccgcatctgcaacgccttggagcgaggcgta
ctctgcgccaatgcgcttctgatgccgtcgggggccgatgcagcagcgtcgatgatgcca
tcggcttcgagcgagaagagcttggccaagtcgctcgaacccgagcaagcagcaacactg
ctcgacttggcgctgcttgcccttgcattccacgcggtgcttgcagagaggcgcatcgct
gcactgggcgcgatggcgagcgctgccgccaagctcctcaaccacaccgtcaatctcgtt
ctgggccggcacgactggacgccggccgagcgattgtcggttctgcaggcgctagcccct
cttctgccgctgcctctcgccgattcagcgagtccgacgtcgagcgacgtcctcctggtg
cagcccggacccagggctggagtgcgtaacgctggatcgtcgaaaaagcggagcgcgcaa
atgccagcgctgagtgctgctgcaaagcaggcgctcgcgacgggcttttggcgaacgctg
ctctcggcgcagggcctgaagcctttactggaatctctctacaactcggtccaccatgac
ctcaccgatgggacggtcgacgcctcgcagccggcatcgctgaacgcaagcctgagcagg
ggcgaatcgagcggcggcgatgtccgcgccacgatcgacgacgacgataacgacgacgat
tttatcggcacggcgaggatggcgtcgcacgatacgtctcgatctcaacgcgaacagggg
gcggccaagggctactcccaggacctcatcgcgctgtgcgtggccgctctggtccaggcg
ccgaagctggccgcggggagcgatgagccgacccaagacgagcgcctggtcaacctcatg
tttgaagggtccctcgactcgctggtgaagctcggtcccagcctggtcgcggcggtgtcg
agcggatgcctctggctgacgctgcgcgacgtcatcgacctgcttgaccagatcggatcg
gatctgctgacttcctaccactttgcgcgcgaccagagggcgagatgtctggccattgac
ctggtgtccgcgacgatgccgatgtggcttggcggcaagcgcctgacgaccgagctgctc
gacaagctgcgcaagctctgcgtcttcttcacggagcaggtcaccaagcaaaagtggcgt
tccccctggaagacccgccgccgggccgccgagttcatcgcagactatatccaggcggac
ccccaggagcgcctctggatcaacgacgacgaggagctgatcagccggtgcccgccgtcc
gaggccgcgctccacctcaactgcgacgccgacgtgcgcgtgcgggcctcgggcgcgacg
atcaccgcgggcctgtttgaccacctcgaccgcgacgacgacggcttcgccgccctctac
gagaagctcaaggagcggctgcccctcgaccatgccaagcgcgaaaacgtcgccacacgc
gtcctctgcctctccaacgtgacaatctcgagctcgtcgctgcgcaacgtctcgctcttt
cacctgctcgagatctttctcgccaccggctcgctcgagcccacgctgaggcgcgcgttt
gaggagattgcggcgaggcttggctttgcgggtcctcggcagctcttcaagtgctttgct
gggcagatcacgtggggcatggtgggcaactcgtacgacccgctcaaggtgccctacaag
atcctcggcttccgctcgcgcaaggagtgcatcgagcagacgttccgggagagcggggcg
atgctgctggcctcggaccaagggtccggcagggactactttgccaccatggcccggacg
gcgcggaagacggtcaaggagggcatccgcgagtgcctgccctttctggctgccagcgag
ctcggtttcgcagccgaggaagcgcagggtgcgccgacaagctccagggcagcgctgtgg
gcgcgcgtcctcgacacgatcaagcagtgggatcccgacgtaggcgcagacgtagacgcg
gcgcagatgctacagctggtcacgtccatcgccgatcaggtcgtgaccgctcttctcgcc
atgttttacgagccggcatcgtcgacagcgtttccggagagcctgcggatcaaggacgaa
gctacacaccgcaacctcatcttcatcgcgccgaccatcgggtctcaggatcgccgcatc
gccgcgcacgagcccaatcggccctttttcgccgcgacgacggtgcacgaggcaatcctc
gtcctcgccgagtccggcgtcgaccccaccggcaccgaggtagcctatcacgtgctgcgg
cagacgttcttccggatcggcaacgcgcctttcgtcaacgaccagcgacgctatgttcag
gcggtccagctgtacgttgccatgtgcgccgaaggagtcagctccagtccgcggctgttg
gacgtgctgctgcagggtatcggcttcctggtcgatcagccatccgtccacgaagcggcg
ctctcgctggcgagctgggccatctcggcgtgtgccaagcaggactggcttcaggcgcgc
gtggcctcgatccttacggagttcgcgcgcactgcggcgttcggaccggacgagggcccg
gcagaaatcatggacaccgcccgggccaccagctccacctgccggtgggccgagacgacc
atcgctgcgctgccgccggcatcggaggctgtccggctggcgttgcacatgtggcccaac
gagatccctccgcagctcaagtcgctcgcgccggccgatgctagacctcgagacatcgct
gccgccctccagcgatgccccgatgtgcgcgtgacggcggccgtgctgaaccggctgcgc
gtcagcctcaaggcagcctcggccgaggagcggcaggcatttgcgcggtcgacggtctgg
ctgctctttgagcgcctccggttggacgagcttcaaggccagcggattgatgagcttgcc
cagatggggcaggcgctttcggagatgctcaacatctgcgagggccgcctccagacacca
ggcctcggcgcgatgcagagcctgccatcgtccgaagtgcacgccgctctcgagtcgacg
atgtcgctcaagaatccgagccgggcattgcaggccgtcacgatcttcatcgtcctccag
cacctccgaggccgaagcatcacgccggcggagcaagcctacgtcgccctgcgcggcatc
ctctcgctcgccaagacgttgacggccgcgctgcccaagtggcccaaccaggcttacgaa
gagctcacgttcctcgccgcattcgaggcgcccgaaccttcggcgccgacacggtcggca
agggagctggaggatcccaccctcgtagcctcggccacggcgttcgaggtctggatccgc
aagatcactggcatcatcagccacatgctgatcaagtcgtcgacgagcacgttctttcac
cacatccagggcctcgtcgagggcgaagccgagattgcgagccgggtgctgcccgttctg
ctgcagctctgcaccgccgacgagtcgtgcgagggcggcgacgaggtgatccgccacctc
gacgcctccagagaggcgattgcacgccacttccgcgaggtcctgacgagcgatggctcc
gatccacgcgcctggtccgccatcatcgagggcctgctgcatgttcgtagatggagtgtt
ctcgagagcgacccgacctcctcggatctgtggttcgacatcgactttctcctccttgcc
cgccgcggcctggactgcaagatgtacacggcggcgttgctcttcgtcgagctctacttt
gagcactcgaccgacgccagcgacgccgaggccaaacagggcgccatctcgtcgcttctc
tacgacgcctacagcaacgtcgaggacccggacggcttctacggcgtcgtcaacgccgat
atccaagagtcgctcactcgtcggctccatcacgaaggcgagtggcatcgcgccctgcag
ctgcacgccgccgcatacgaggcgtcggccaccctgctcaagtccgccggcaaggggatc
ggccagctggtcgccaaagacttccacatgcttggcttcaaccgcttggcctcgatgctg
caaggccccgccactccggcctcaagcgcgccggtcctcggcgccgcgggcccgcagtac
ggcggattccagtacgacatggcgtggaggatgggctcctgggacctcccatgcagcgac
ccttatgtcgcaggcactagccgcggcacgtacgctgcactgaaggcgcttcaccgcgac
cgctcgggcgcatcgattgatcgagcagtggccggaggattcgcacgggagctagagggg
ctcgccggcgccaagccggaggcgatcaacgatgtccggaaggtccagctcgatctcttg
agcctccacgaggtgcgggagtggcgtcagcttgcctcgcaactcggcgcagaggaggct
gtcgcccacttgaccgccttttgggccgagccccggccgacattccacatcgagtgccac
gagcgggtgctgtcggtgcgtcagtcgatcctgcaggccgagcggacccgtggacagctc
cacgagatcggcaatctgctctcccctgctgccgaggaatcgatgaggctcgagaggtcg
atgatgatctgcctcagcgctgccgcacgcaagcagggccgaatccaggtctcgatcaat
gccacctccgaggcgcagcggcttcaggcggcgctgtcggacaaatcgaacctcaccgat
gaggagtttgcctcggtcctctgggcgcagggcgagcatgcgttcgcgctcgagtcgctc
ggcgccatcatcgaggccttccaggttggcgagaagtcggcagtccgctcgaggtaccgc
aaggctgtgctcatggcgaggctgggcgagtggcgagccacggcgcgatcgcagcagccg
cgggccatcgacacgacgctgtttaagcctgcgctcgagctcatggtcgcgcagagcagc
ggacacgcacaaagcaccgaggagcaggccaaggtggcgtacaaatgggccaaattcgca
gacgagcagtaccgcggtgtcgacgccgaagagattgagcggctcaaggtgtacatcgac
cgccgcaaggaggaaatccgccagaaccaggtcgagagcgaccggacggtctcgcggagc
ctcaagcagcggctgatgcagttccagcggcaggcggagaagatcctgcgtcaggacgag
aaccacctcaaggagctcgagtcggcgcgcaccctctttctgcagagggccattgccatg
tactcgcgctcgctcaccatgtcggaccgctatgacgatgccgtcggccgcctcacgtcg
ctgtggttcgacaacgcgtttgacgaaaacgccaaccgcccgctctcggcgacgctgccg
cagattccctcgcacaagttcataccgctcacgcaccagctctctgcgcgcctctcgacc
gccaagggatccgcaggcaagggcttgtcgacgttccagaccaacctctcggatctggtg
ctgcgcgtgtgccgcgatcaccctttccacacgctgtacgcgctcttcgcgctactcaag
gcgggcaaggacgccaaggccagcgagcggcgcgacgtgtcggcctcgcagggcgccgag
tcgtcgcagcgacagaggtcgatggcggccgaatcgatctgggtgcgtgtccggacgacg
gaccggctccggcggcgcctgcaggttttcgacgaagtctgccaggcctatgtcgagtgg
gccgaagtcaaccttgcccagcagttcagccggtactttacgcccaacggcgcgatcaag
cgcggtccgctccgcatgccgcccgcctcggagctcaggctggtccggctgcgcgacgtc
gatgtgcctgtggcgacggccgaggtgcccatcgaccggtcgtgcgagtaccgcgacatt
gtctcgattgtgcgttacagcgagacgttcaccacggccggcggcatccacctccccaag
atcaacgagtgcatcggcagcgacggcaagcggtacaagcagctgtttaagcgcgacgac
gatctgcggcaggacgccgtcatgcagcaggtgttccggctggtcaacggcctgctggat
cgcgaccgcaaggccagccagcggcgcctgacggtccgcacgtacgccgtgatcccgctc
ggcccgcagtgtgggctgctcgaattcgtcaccaacacggtgcccatcggcgaggtgctg
atccgaatgcacggccagtacgggcccaaggacatgtcgccgatggaggcgcggacgcgg
atccgcgaggcccagggcttgacggcgagccagaagctcgaagtgttcctcgacgtgtgc
gagcgcatgccgccggcgttccgcttctttttcaccgagcgccaaaaggacccgcccagt
tggttcgccatgcgcctcaactatacccggagcgcggcgacgacgtcgatcgtcggccac
atcctcggactcggcgaccgccacgtgtccaacatcctcctcgacaagcagagcggagag
ctggtccacatcgactttggcgtggcctttgaccagggcaagctgctgccgattccggag
ctggtgccgttccggctgacgcgcgacctggtcgacggcatgggcctctcgggcatcgag
gggacgtaccggcggtgctgcgaggagacgctgcgggtgctgcgcgacggccgcgacgtg
gtcaagacggtgctcgaggtgttcaagcacgatccgctgtttgtatggacgtcgaacccg
atcaaggtgctcaaggcgcagggtgctgcgggcggcggcggcgacgacgacgacgacgag
acaaacggcggtggcggggatgagagcgcggtgggtatgggagcgcgaggccgcggcagg
aggagcgaccacggacgcggtgccgcgcctagcgtcgagcctacgccgccgccgccgcct
aatccctctgccacgtcgctcatgacgattgacacggcggagctgagcgccgaccgggcc
attacgtcggtcatgaccaagctctcgtcgagcctgagcgtcgagtacacggtcaacgag
ctcatccagcaggccatggacgccggtaacctctcggccatcttccaaggctggcaggct
gccctgtag

DBGET integrated database retrieval system