KEGG   Anthracocystis flocculosa: PFL1_06748
Entry
PFL1_06748        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfp  Anthracocystis flocculosa
Pathway
pfp00480  Glutathione metabolism
pfp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFL1_06748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfp02000]
    PFL1_06748
Enzymes [BR:pfp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PFL1_06748
Transporters [BR:pfp02000]
 Other transporters
  Pores ion channels [TC:1]
   PFL1_06748
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin
Other DBs
NCBI-GeneID: 19320819
NCBI-ProteinID: XP_007882485
UniProt: A0A061H4W1
LinkDB
Position
Unknown
AA seq 288 aa
MSSQPKQPGAKGANYHKECTGEALETAKAHSQPSELVLFGACFCPFVHRVWIALEAMHIP
YQYVEVDPYAKPKALLDLNPRGLVPALKLGKSEGKGLGESTVIMEYLEEAYSLSSTSSGD
HPSLLPPLSDAYSRALARLAADKLNRNLIPAFYRYLQAQTTEKQIEGAKDFLSALHDFID
SMHPPSSSSAGFWNGSKLSWTDVMVAPWLFRATNVLRHFRGFEWDKMIEGQERKDRFRAW
TQAVFAHEAFRKTTSSEELYLDSYVRYAENRPNTSQVANAINSGRALP
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtcgtcgcagcccaagcagcccggcgcaaagggcgcaaactaccacaaggaatgcacc
ggcgaggcactcgaaaccgcaaaggcccacagccagcccagcgagctggtcctctttgga
gcctgcttctgcccctttgtccaccgcgtctggatcgccctcgaggctatgcacatcccg
taccagtacgtcgaggtcgatccctacgccaaaccaaaggcgcttctcgacctcaacccc
cgaggcctcgtgccagcgctcaagctgggtaagagcgagggaaaggggcttggagagtcg
acagtcatcatggagtacctcgaggaggcctacagcctctcctcgaccagctccggcgac
cacccttccctgctccccccactctccgacgcctactcccgcgccctcgcccggctggcg
gcagacaagctcaaccgcaacctgatcccggccttctaccggtacctgcaagcccagacg
acggaaaagcagatcgagggcgcaaaggacttcctctcggcgctccatgactttatcgac
tcgatgcacccgccctcgtcttcgtcggccggtttctggaacggctcgaagctgtcgtgg
accgacgtcatggtcgccccctggctcttccgggccacgaatgtgctccgccacttccgc
ggattcgagtgggacaagatgatcgagggccaggagagaaaggaccgcttccgagcctgg
acgcaggccgtcttcgcccacgaggcattcaggaaaacgacgtcgtcagaggaactctac
ctcgacagctacgtgaggtacgccgaaaacaggcccaacacgtcccaagtcgccaacgcc
atcaactcgggtcgcgctctgccctga

DBGET integrated database retrieval system