KEGG   Anthracocystis flocculosa: PFL1_06748Help
Entry
PFL1_06748        CDS       T03141                                 

Definition
(RefSeq) hypothetical protein
Organism
pfp  Anthracocystis flocculosa
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-GeneID: 19320819
NCBI-ProteinID: XP_007882485
UniProt: A0A061H4W1
LinkDB All DBs
Position
Unknown
AA seq 288 aa AA seqDB search
MSSQPKQPGAKGANYHKECTGEALETAKAHSQPSELVLFGACFCPFVHRVWIALEAMHIP
YQYVEVDPYAKPKALLDLNPRGLVPALKLGKSEGKGLGESTVIMEYLEEAYSLSSTSSGD
HPSLLPPLSDAYSRALARLAADKLNRNLIPAFYRYLQAQTTEKQIEGAKDFLSALHDFID
SMHPPSSSSAGFWNGSKLSWTDVMVAPWLFRATNVLRHFRGFEWDKMIEGQERKDRFRAW
TQAVFAHEAFRKTTSSEELYLDSYVRYAENRPNTSQVANAINSGRALP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgcagcccaagcagcccggcgcaaagggcgcaaactaccacaaggaatgcacc
ggcgaggcactcgaaaccgcaaaggcccacagccagcccagcgagctggtcctctttgga
gcctgcttctgcccctttgtccaccgcgtctggatcgccctcgaggctatgcacatcccg
taccagtacgtcgaggtcgatccctacgccaaaccaaaggcgcttctcgacctcaacccc
cgaggcctcgtgccagcgctcaagctgggtaagagcgagggaaaggggcttggagagtcg
acagtcatcatggagtacctcgaggaggcctacagcctctcctcgaccagctccggcgac
cacccttccctgctccccccactctccgacgcctactcccgcgccctcgcccggctggcg
gcagacaagctcaaccgcaacctgatcccggccttctaccggtacctgcaagcccagacg
acggaaaagcagatcgagggcgcaaaggacttcctctcggcgctccatgactttatcgac
tcgatgcacccgccctcgtcttcgtcggccggtttctggaacggctcgaagctgtcgtgg
accgacgtcatggtcgccccctggctcttccgggccacgaatgtgctccgccacttccgc
ggattcgagtgggacaagatgatcgagggccaggagagaaaggaccgcttccgagcctgg
acgcaggccgtcttcgcccacgaggcattcaggaaaacgacgtcgtcagaggaactctac
ctcgacagctacgtgaggtacgccgaaaacaggcccaacacgtcccaagtcgccaacgcc
atcaactcgggtcgcgctctgccctga

DBGET integrated database retrieval system