KEGG   Pragia fontium: QQ39_00895Help
Entry
QQ39_00895        CDS       T03952                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pfq  Pragia fontium
Pathway
pfq00473  D-Alanine metabolism
pfq01100  Metabolic pathways
pfq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    QQ39_00895
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    QQ39_00895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfq01011]
    QQ39_00895
Enzymes [BR:pfq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     QQ39_00895
Peptidoglycan biosynthesis and degradation proteins [BR:pfq01011]
 Precursor biosynthesis
  Racemase
   QQ39_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AKJ40804
UniProt: A0A0G3CFN3
LinkDB All DBs
Position
complement(218194..219423)
Genome map
AA seq 409 aa AA seqDB search
MSLRLRHLALIPLLTLVACHQTTSVTPTQLSSASTQDSSTVVSNARIEISQRALEYNIQK
VQKLLGNKSTLCAILKGDAYGHDISLVTPIMLKNNVQCIGVASNQELKTVRDLGFTGRLM
RVRIATEEEMKQATSYDVEELIGNLDMAKRLDAIAAQQGKTLRIHLALNSGGMSRNGLEV
GNANGLNQSRTISQLSHLKIVGIMSHYPEEDPAAVRKDLARFKVQAQQVLDITGLKRDDV
MLHVANTFATLTVPESWLDAVRVGGVFYGDTIASTDYLRVMTFKSNIAALNHYPKGNTVG
YDRTYTLKRDSVLANIPVGYADGYRRVFSNAGHVLIQGQRVPVVGKTSMNTVMVDVTDLK
NVQPGDEVVFFGKQNQAEITATEVEDISGALFTEMSILWGATNQRILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgcgtttacgccatttagcgttaataccgctattaacgctggttgcctgtcat
cagaccaccagcgtcacacccactcagttatcttcagcaagcactcaagactcatccacc
gtcgtgagtaatgccagaattgaaatttcacagcgcgctttggaatacaacatccagaaa
gtacaaaagttactgggcaataaatcgaccctgtgtgccattctgaaaggggatgcctac
ggacacgatatttcactggtcacgccaattatgctgaaaaacaatgtgcagtgtattggg
gtagcgagcaatcaggagctgaaaaccgtacgcgatctgggtttcaccggccgtctgatg
cgcgttagaattgccaccgaagaagaaatgaagcaggcaacaagctacgatgtagaagaa
ctgatcggcaatctggatatggcaaaacgtctggatgccatcgccgcccaacagggcaaa
acgctgcgcattcacttggcactcaactccggcggtatgtcacgtaatggattggaggtc
ggcaacgccaatggacttaatcaatcccgaactatctcacaattaagccatttgaaaatt
gtcggtattatgtcgcattaccctgaggaagatccggccgcagtgcgtaaagatctcgct
cgcttcaaggttcaggcacaacaggttctggatattaccggccttaagcgtgatgacgtg
atgctacacgtcgctaacacgtttgctactttaactgtgccagaatcctggcttgatgcg
gtgcgcgtcggcggggtgttctatggtgacacgattgccagtaccgactatctgcgcgtg
atgacctttaagtccaacatcgccgccctgaatcactaccctaaaggaaataccgttggc
tacgatcgcacttacaccttaaagcgtgattctgtgttagcgaatatcccggttggctat
gccgatggctatcgtcgcgtctttagcaatgcaggccatgtgcttattcagggccagcgg
gtacccgttgtcggtaaaacctcgatgaataccgttatggttgatgttaccgatctaaaa
aatgtccagcccggtgatgaagtggtattttttggcaagcagaaccaagcggaaatcacc
gcgaccgaagtcgaagacattagcggtgcactatttaccgaaatgtcgatactttggggc
gctaccaatcagcgcattctggtggattaa

DBGET integrated database retrieval system