KEGG   Pragia fontium: QQ39_01285Help
Entry
QQ39_01285        CDS       T03952                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pfq  Pragia fontium
Pathway
pfq00564  Glycerophospholipid metabolism
pfq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    QQ39_01285 (glpD)
Enzymes [BR:pfq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     QQ39_01285 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 Pyr_redox_2 FAD_oxidored 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKJ40877
UniProt: A0A0G3CP18
LinkDB All DBs
Position
313371..314876
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPLRFRLPHQPHLRPAWMIRAGLFLYDHLGKRTSLPSS
NGLKFGPDSVLKSELTRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREEG
IWVVEAYDETTGETLTWRAKGLVNATGPWVKQFYDDGLQLKSPRGIRLIKGSHIVVPKVH
NQPQAYILQNEDNRIVFVIPWLGEFSIIGTTDVEYHGDPHDVKIDDNEVNYLLKVYNDHF
KKQLNKDDIVWTYSGVRPLCDDESDSAQAVTRDYTLEVADDAGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGIGPAWTKNGVLPGGDMGTDRNSYAAQLRRKHDWLPDTLAIHYAQT
YGSRTEMLLENKNSLADLGEDFGHDLYEAELEYLVAKEWALELDDVIWRRTKLGMWLSEE
QQQRVAAWLKDVAGRKTRFAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacctaatagttatcggcggtggaatcaatggtgcaggtattgcagct
gatgctgccggacgtgggctttccgttctactgttggaagcccgggatttagcctgcgca
acctcctcggccagttcgaagttgattcatggtggattacgctatctggagcattatgag
ttccgtctggtcagtgaagcattggccgagcgggaagtgctgctgcgcttagcgccacat
attgcgttcccattacgcttccgcttgcctcaccagccgcatttacgtccggcatggatg
attcgtgctggtttgttcttgtacgatcatttgggcaaacgaaccagtctgccatccagt
aacggtctgaagtttggcccggactcggtgttaaaatcggagttgacccgtggctttgaa
tattctgactgttgggttgatgatgcccgcttggtcgttctgaacgctcaggaagtggtt
gagcgcggtggtgaagtacgtacccgtaccaaagtgacccgcgcctggcgtgaagagggt
atctgggtagtggaagcttatgatgaaaccaccggtgaaaccctgacttggcgtgccaaa
ggcttagtgaatgcgaccggcccatgggtgaaacagttctatgatgatggcctacagcta
aaatcaccacgcggtattcgcttgattaaaggcagccatattgtggtaccaaaagtacac
aatcagccgcaagcgtatattttacagaatgaagataaccgtattgtttttgttatccca
tggttgggtgagttctccattatcggtacgaccgacgtggaatatcatggcgacccgcat
gatgtgaagattgacgataatgaagtgaattacctgctgaaagtgtataacgatcacttt
aaaaagcagctgaacaaagatgatattgtctggacctattctggcgttcgcccactgtgt
gatgatgagtctgattctgctcaggcggtaactcgtgattatactttggaagttgctgat
gacgctggcaaagcaccgctgctatcagtattcggcggtaaattgacgacctatcgtaag
ctggctgaacacgcgatggagaagttagctcattattatccgggtatcggcccagcatgg
accaaaaacggtgtactgcctggtggtgatatgggtaccgatcgcaatagctatgcggct
cagctgcgccgtaagcacgattggttacctgatacgctggctattcactatgcccagact
tatggttcacgtaccgaaatgctgctggaaaacaaaaatagtctggctgacctgggtgaa
gacttcggtcatgacctgtatgaagccgagctggaatatctggtagctaaagaatgggct
ctggagctggacgatgtgatttggcgtcgtaccaagttaggtatgtggctgagtgaagaa
cagcagcagcgcgtcgcagcttggttaaaagatgtcgcgggtagaaaaactcggtttgct
gaataa

DBGET integrated database retrieval system