KEGG   Pragia fontium: QQ39_09170Help
Entry
QQ39_09170        CDS       T03952                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfq  Pragia fontium
Pathway
pfq00480  Glutathione metabolism
pfq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    QQ39_09170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfq02000]
    QQ39_09170
Enzymes [BR:pfq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     QQ39_09170
Transporters [BR:pfq02000]
 Other transporters
  Pores ion channels [TC:1]
   QQ39_09170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6 GST_N_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AKJ42237
UniProt: A0A0G3CSY4
LinkDB All DBs
Position
complement(2078569..2079174)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLSPHIILNEAGLNYSVEKVDLATKKTEHGDDFLQINPKGQVPTLQLDDG
SILTEGVAIVQYLAHKVPAKHLIPAVGTPEYYHAIEWLNYISTELHKGFSPLFTPQTPEE
YKKIAKERLLKQFTYVDSVLQKHQFILGSTFSVADAYLFTVTNWAAVVKLDLSHLSALAA
YMKRIADRPAVNATLKAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattttataagcctggagcttgctcgttatctccacatatcattctcaacgaa
gccggactgaactattcagtagaaaaagtcgatttggcgaccaaaaagaccgaacacggt
gacgactttctgcaaattaaccctaaaggtcaagtgccaacgctacagttagatgatggc
agcattctaaccgaaggtgtggctattgttcagtatcttgcccataaagtaccggctaag
cacttaatccctgcggtaggtacacctgagtattatcacgccattgagtggttaaactat
atctcaactgagctacacaaaggttttagtccgctgtttactcctcaaacgccagaagag
tataaaaaaatagcgaaagagagattgttaaaacagtttacctatgtcgacagcgtacta
cagaagcaccaatttattttgggctctaccttcagcgtagcagatgcgtacctgtttacc
gtcactaactgggccgccgtggttaaacttgatttaagccatctgagtgcgttagctgct
tatatgaagcgcattgcggatagacctgccgtcaacgccaccttaaaagcggaaggtttg
aaataa

DBGET integrated database retrieval system