KEGG   Pragia fontium: QQ39_15800
Entry
QQ39_15800        CDS       T03952                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
pfq  Pragia fontium
Pathway
pfq00270  Cysteine and methionine metabolism
pfq00920  Sulfur metabolism
pfq01100  Metabolic pathways
pfq01110  Biosynthesis of secondary metabolites
pfq01230  Biosynthesis of amino acids
Module
pfq_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:pfq00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    QQ39_15800
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    QQ39_15800
Enzymes [BR:pfq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     QQ39_15800
    2.3.1.46  homoserine O-succinyltransferase
     QQ39_15800
SSDB
Motif
Pfam: HTS
Other DBs
NCBI-ProteinID: AKJ43343
UniProt: A0A0G3CTT6
LinkDB
Position
complement(3626956..3627885)
AA seq 309 aa
MPICIPDELPAVNVLRNENVFVMTSTRASHQNIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQLDIQLLRINNHESKNTPAEHLNNFYCNFEDIQDQNFDGLIVTGAPLGLVEFKDVIY
WDEIEKITNWAKEHVTSTLFVCWAVQAALNILYNIPKLTMTEKLSGVYWHNIVEPLAPLT
RGFDDRFLAPHSRYAHFPSDVIRQHTDLEIYAESEQTGAYLFASKDRRFAFATGHPEYDA
HTLSAEYFRDFDAGLAPAIPENYFPQDNPELPPTASWRSHGYLLFNNWLNYFVYQRTPYD
LRQMNPTMD
NT seq 930 nt   +upstreamnt  +downstreamnt
atgccgatttgtatacctgatgaactcccagccgttaatgtattacgcaatgaaaacgta
tttgttatgacgtcaacgcgtgccagccatcagaatatacgtccgctaaaggtacttatt
cttaatcttatgccaaagaagattgagacagaaaaccagtttttgcgtctgctatccaat
tcgcctttacagttggatattcagctattgcgaatcaataaccatgagtcgaagaatacg
ccggcagagcacctgaataacttctactgtaattttgaagatattcaggatcaaaacttc
gatggtctaatcgttaccggtgcgccgttaggactcgttgaatttaaagatgtgatttac
tgggatgagattgaaaaaatcaccaactgggccaaagagcacgtaacatctacgctgttt
gtttgctgggcagtacaggcggcgttaaatattctctacaatattcctaagctaaccatg
acagaaaaactgtctggagtgtattggcataatattgtggaaccactggcgccgttgacc
cgtggctttgacgatcgtttcctcgctcctcattcacgctatgcgcattttccttcagat
gtgattcgtcagcacaccgatttggaaatttatgcggagtcagagcaaaccggcgcttac
ctgtttgccagtaaagatcgccgctttgctttcgcaaccggccatcctgaatatgatgct
catactttatcggcagaatattttagagatttcgatgccgggctggcgccagccataccg
gaaaactatttccctcaggataaccccgaactaccgccaacggcttcttggcgcagccac
ggttatttactgtttaataactggctgaattactttgtctatcaaagaacgccatacgat
ttacgccaaatgaatccaacgatggattag

DBGET integrated database retrieval system