KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_02290
Entry
PFREUD_02290      CDS       T01252                                 

Definition
(GenBank) Hypothetical secreted protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00620  Pyruvate metabolism
pfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFREUD_02290
Enzymes [BR:pfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     PFREUD_02290
SSDB
Other DBs
NCBI-ProteinID: CBL55744
UniProt: D7GI22
LinkDB
Position
complement(269199..272594)
AA seq 1131 aa
MSVVERRQINAAINLRLSLLGLPHPDSNAESPDAILVEPLLARQRELSRRLKDRLSAPDL
RIQRFLDDYLADCDEHPQLPRTTLVLDEPGLARGLSLPVDGDEFHSDIVASYRLVNGVLH
NPKHDRRTTAGVFHISTGGLPIPQDKVEVDKNVYARILARAFQAPDEELALPYTANLPEQ
AHCWASLLMRPTVLPAVPGRTTEKSYEVHFIVPGGLMCNLDFVEGIFGNAGDPYLPENDA
SLDPDSWTGHTGCVILAPHLTTMTKKSLGMPHYDDATERQRRDGQCWRHEDDLYNDGKAF
KVCARDERGVIVTVIADNYFGYCKKEVKTQISYSANLLGGAEEEHSGGAEVYPAWNLNQD
FTDRTPDDFTLADVISTNRELLDVRPEGYAVYKPEPNIVFIPEHSHYSMRTQTISWTAHG
AEQTIKLLAGKHYLSPDGYRIHAKHREMDATQWHLIGTSSRAVTCHKPATVSGGGKSEIS
KSISDAFVFGNAFSHDIDSAMDQVQALFDTDFTNRFADASRNGTDHRPVLSIDRSLGSVI
KLLTPSIQYNDEYNAFLEGIEPDVKELAFTVKRYYLPEWGEDWRSHFTVGIMNGRHGNMV
RLDGKKIITNMLRVGFREDGSWRLFTLRPDYSPAVKVQTEDDITASTVTPPWEDAEGLPR
KYVTNCEHLLFQRPDDAIHRGYDKQAEFDLASGTDTFISNFEPLTHEQARDLLTDVQAYS
EFTKPVRKLIERVAAMPDDQSPEFWVCSDDPRHLPDGGRSKNPRYLQVRPTDSNPELTTV
ADVAGKLARKLPLAGHAPQPIDVVAAGRRNNPPEDKVPALCAYNPLHYMELPELFMEYIS
SMTGKSPSTTGAGSEGALTKGPFNALPAVYDLNAAVLSYALTDYDGWLSSAGYIGPNARV
DHDISMLIPELFSHMGPNDRNTKRLISEGYLEKMQDFDFDGHRVLASRLGYRINDRFVTH
YFGRIFLHPDVVFSEEMLRPELQDEKIFADSIDVIVKTHQRVAQMYFDDGTVSLACPPIR
ALLEIMAHGASAEGWTLDSPEFRKLFERESVLASDWYAARLDAKQAEDVKQTEEGVERLK
EYIERPDSGSVSARLHLADRLRELEAQLTYERSPEYRRSLVGTLGRQPRFV
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgtccgtagtcgaacgccgccagatcaacgcagccatcaacctgaggctttcgttgctg
ggcctgccccatcccgacagcaatgctgagagccccgatgcgatccttgtggagccgctg
ctggcccgccagcgcgagttgagtcggcggttgaaggatcggctcagtgcccccgacctg
cgcatccagcgcttcctcgacgactacctggccgactgcgatgagcacccccagctgcca
cgcaccaccttggtgctcgacgagccgggcctggcccgcggcctgtcgctgccggtggac
ggcgacgaattccattccgacatcgtggcgtcatatcgccttgtcaacggcgtattgcac
aaccccaagcatgaccggcgcaccaccgccggggtgttccacatctccaccggcggcctg
cccatcccccaggacaaggtggaggtggacaagaacgtctacgcccgcatcctggcgcgc
gccttccaagcccccgacgaggagctggcgctgccctacaccgccaacctgcccgagcag
gcgcactgttgggcgtcgctgctcatgcgccccacggtgttgccggccgtgcccgggcgc
accaccgagaagagctacgaggtgcacttcatcgtgcccggtggcctgatgtgcaacctg
gacttcgtggagggcatcttcggcaatgccggcgacccctacctgcccgagaacgacgcc
tcgctcgacccggacagctggaccggccacaccggctgcgtgatcctggccccgcatctc
accacgatgaccaagaagagcctgggcatgccgcactacgacgacgccaccgagcgccag
cgtcgcgatggccagtgctggcgccacgaggacgacctctacaacgacggcaaggccttc
aaggtgtgtgcccgcgatgagcgcggcgtgatcgtcaccgtgatcgccgacaactacttc
ggctattgcaagaaggaggtgaagacccagatcagctattcggccaacctgttgggcggt
gccgaggaggagcactccggcggcgccgaggtgtatccggcatggaacctgaaccaggac
ttcactgaccgcacgcccgacgacttcacgctggccgatgtgatctccaccaatcgcgag
ctgctggacgtgcgccccgagggatatgccgtctacaagcccgaacccaatatcgtgttc
attccggagcattcgcattattcgatgcgcacccagacgatcagctggaccgcccatggc
gccgagcagaccatcaagttgctggccggcaagcactatctgtcgcctgacggctatcgc
atccatgccaagcaccgtgagatggatgccacccagtggcacctgatcggcacctcgtcg
cgggcggtcacctgccacaagccggccacggtgtcgggtggcggcaagagcgagatcagc
aagtcgatcagtgacgccttcgtgttcggcaatgccttctcgcacgatatagacagcgcc
atggaccaggtgcaggcactcttcgacaccgatttcaccaatcgctttgccgacgcgtcc
cgcaatggcaccgaccatcgtcccgtgttgtcgatcgaccgctcgctgggttcggtgatc
aagctgctcaccccgtcaatccagtacaacgatgaatacaacgccttcctcgagggcatt
gagcccgatgtgaaggaattggcgttcaccgtcaagcgctattacctgcccgaatggggt
gaggactggcgcagccatttcaccgtgggcatcatgaatggccggcacgggaacatggtg
cgcctggacggcaagaagatcatcaccaatatgttgcgggtgggtttccgtgaggacggc
tcgtggcgcctgttcacgctgcgccccgattacagcccggccgtgaaggtgcagaccgag
gacgacatcaccgccagcacggtgaccccgccgtgggaggacgccgagggcctgccgcgc
aagtacgtgaccaactgcgagcacctgctgttccagcgtcctgacgatgcgatccaccgc
ggctacgacaagcaggccgagttcgacctggccagcggcaccgacaccttcatctcgaac
ttcgagccgctcacccatgagcaggcacgcgacctgctgaccgatgtgcaggcctacagc
gagttcaccaagccggtgcgcaagctcatcgagcgggttgccgcgatgcccgacgaccag
tcgcccgagttctgggtgtgctccgatgatccgcgccacctgcccgacggcggccggtcg
aagaacccgcgctacctgcaggtgcgtcccaccgactccaacccggagctgaccacggtg
gccgatgtggccggcaagctggcacgcaagctcccactggcaggccatgcgccgcagccg
atcgacgtggtcgccgcgggccggcgcaacaatccgccggaggacaaggttccggcgctg
tgcgcctacaacccgctgcactacatggagctgcccgagctgttcatggagtacatcagc
tcgatgaccggcaagtcgccgtccaccacgggtgccggctcggagggcgcgctcaccaag
ggcccgttcaacgcgctgcccgcggtctacgacctgaatgcggcggtgctgagctatgcg
ctcaccgactatgacggctggctcagctcggcgggctatatcgggccgaatgcccgggtt
gaccacgacatctcgatgctgattcccgagctgttctcgcacatggggcccaacgaccgc
aatacgaagcggctgatctccgagggctacctggagaagatgcaggacttcgacttcgac
gggcaccgcgtgctcgcgagccggctgggctaccgcatcaacgatcgtttcgtcacccac
tacttcggacgcatcttcctgcaccccgatgtggtgttcagcgaggaaatgttgcgtcct
gagctccaggacgagaagatcttcgccgattcgatcgatgtgatcgtcaagacgcaccag
cgggtggcgcagatgtacttcgacgacggcaccgtgtcgctggcctgcccgccgatccgg
gcgctgctggagatcatggcgcacggcgcgtcggccgagggttggacgctggacagcccg
gagttccgcaagctgttcgagcgcgagtcggtgttggcctctgactggtatgcagcccgc
ctcgacgccaagcaggccgaggacgtgaagcagaccgaggagggcgtcgagcgcctcaag
gaatacatcgaacgccccgattcgggctcggtgtcggcgcgcctgcatctcgccgatcgc
ctgcgtgagctggaggcgcagttgacctatgaacgctcgccggaataccgccggtcgctg
gtgggcacgctgggacgtcagcccaggttcgtctga

DBGET integrated database retrieval system