KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_07050Help
Entry
PFREUD_07050      CDS       T01252                                 

Definition
(GenBank) zinc-binding dehydrogenase
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 Glu_dehyd_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: CBL56236
UniProt: D7GCH5
LinkDB All DBs
Position
complement(807515..808558)
Genome map
AA seq 347 aa AA seqDB search
MAETMLAERFYAKDHSIHLEEIPIPEPGPGEVLMKVAYCGICHSDLSLINGNFPPSLPVV
TQGHEASGTIVKLGPGVTGWSVGDRVIPSAGRPCMVCRKCRRGDFANCLHLHLMAFAYDG
AWAQYHVASAMGLTKIPDNVAMDQAALLADAVSTPYAAVVRTAQVHSGNAVAVWGVGGVG
THLVQLARSAGAVPLIAIDLNDEVLERAKRLGADFAFHSDDPDLMKKIEEVTNGRMIDVA
FDAVGIQATVRAAVESLDVNGKVVTLGLSDQDIDAGPFLDFNLQRKQVRGHLGYQGQDIA
ILAEMLSFGRLDLSESISDVVPLSEVERGIDDLKNHKGNPIRILVKP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacgatgcttgccgagcgtttctacgcgaaggaccacagtattcacctcgag
gagatcccgatccccgaaccgggacccggcgaggttctcatgaaggtcgcctactgcggc
atctgtcattctgacctgagcctgatcaatggcaacttcccgccgtcgctgccggtggtc
acccagggtcacgaggccagcggcaccatcgtcaagctcggaccgggtgtcaccggttgg
agcgtcggcgaccgtgtcatcccctcggccggacgtccctgcatggtgtgccgcaagtgc
cgccgcggcgacttcgccaactgcctgcacctgcacctgatggccttcgcctacgacggc
gcctgggcccagtaccacgtggcctcggccatgggcctcaccaagatccccgacaacgtt
gccatggatcaggccgccctgctcgctgacgcagtgtccaccccctatgccgccgtggtg
cgcaccgcccaggtgcacagcggaaatgccgtggccgtatggggcgtcggcggcgtcggc
acgcacctcgtgcaattggcgcgtagcgccggcgccgtgccgctgatcgccattgacctg
aacgacgaggtgctggagcgggccaagcgcctgggcgccgacttcgccttccactccgat
gatcccgacctgatgaagaagatcgaggaagtcaccaacggccgcatgatcgacgtcgcc
ttcgacgccgtcggcatccaggccacggtgcgggcagccgtcgaatcgctcgacgtcaac
ggcaaggtcgtcacgctgggcctgtccgaccaggacatcgacgccggcccgttcctggac
ttcaacctgcagcgcaagcaggtgcgtggccacctcggctaccagggccaggacatcgcg
atccttgccgagatgctctcgttcggacgcctggacctgtccgaatccatcagcgacgtg
gtgccgctgtccgaggttgagcgcggcatcgacgacctgaagaaccacaagggcaacccg
atccgcatcctcgtgaagccctga

DBGET integrated database retrieval system