KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_10250Help
Entry
PFREUD_10250      CDS       T01252                                 

Gene name
odhA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 and E2 components
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Pathway
pfr00020  Citrate cycle (TCA cycle)
pfr00310  Lysine degradation
pfr00380  Tryptophan metabolism
pfr01100  Metabolic pathways
pfr01110  Biosynthesis of secondary metabolites
pfr01120  Microbial metabolism in diverse environments
pfr01130  Biosynthesis of antibiotics
pfr01200  Carbon metabolism
Module
pfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFREUD_10250 (odhA)
  Amino acid metabolism
   00310 Lysine degradation
    PFREUD_10250 (odhA)
   00380 Tryptophan metabolism
    PFREUD_10250 (odhA)
Enzymes [BR:pfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PFREUD_10250 (odhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: CBL56549
UniProt: D7GDD8
LinkDB All DBs
Position
complement(1154235..1158020)
Genome map
AA seq 1261 aa AA seqDB search
MGTDKFGANDWLIADMRQRYLADPTSVDERWRAYFQALGVTPDPSTPVASPAPVTPAPTQ
APTPQAPTPQAPTSSAPGPNEPAQPPSSRVQAPVPTLEPREIRRNAPEQPGMGGGLSADV
PNPAVRPAKKAEGQATRTVLRGIPKTTAVNMNESLSVPTATSVRQVPMKLVIDNRALVNS
FMARTRGGKVSFTHIIAFAMVQAIRDVPEMNHSFDMTDGKPTLVENPAINLGIAIDTTAK
NGTRELLVPNIKDAGNLDFAQFWSAYEDLVDRTRSGKLTLEDYAGTTVSITNPGGIGTNM
SVPRLMSGQAMIMGVGSIDYPAAFQGTSTQRTNDAAISKVCTLTSTYDHRIIQGAVSGEF
LRRIHQLLLGADGFYEHIYEALRIPYPPLHWDRDFTANSQSEISKGARVTELIQAYRAEG
HLLADLDPVEYRMRTHPDLDLATHGLSIWDLDREFPVGRFGGEEGRHIVLRQMLDILRES
YCYTLAIEYMHIDDPEERAWVQERFERPRKPRPREEHLLILDRLSEAEVFETFLQTKYVG
QTRFSMEGAESSIVILSELCAAAADGGMAEVSIGMPHRGRLNVLTNVVGKLYSQVFREFD
NKVPTEEDITGDVKYHLGATGQFTAMSGEKIKVSLAANPSHLEAVDPVLEGIARAKRDRQ
PVPADYPVLPILMHGDASFSAQGIVYEVLQMSQLRPYRVGGTVHLVVNNQLGFTTSPSDG
RSSKYCTDVAKALGAPVIHVNGDDPDACARAAELAFDFRARFHKDVVIDMVCYRLRGHNE
GDDPSFTQPQMYDLVARKGSVRKIYTDALIGRGDISVEDAEQAVNRFRARLEEVFSMVRN
PEIPRDEVDHQVAYRLAPQYPAKERAASAPPTPTREQFERVADVYENLPEGFTPHPKVGP
QLKRRADSIHNGPVDWATAELLAFGTLLQDRRHVRLVGQDTRRGTFSQRFGAVVDRVTNE
AWVPLKHLSDDQAPFDIYDSNLTEYAGMGFEYGYSTAAPDALVLWEAQYGDFANGAQTIA
DEFISSGFAKWQQRSGVVLLLPHGYEGAGPDHSSCRIERWLQTADEGNIAVTMPSTAASY
FHLLRQHAYVNWHRPLVVATPKSMLRNKAAASPLSDLLDEPWRPALADPTITDPGAVRRV
LLCAGKIRWDLVAERRKLGLDGQIAIVSLERLFPLPTAELAEILRAFPQVNDFRYVQEEP
ENQGAWEFMDRFLTPALSEALNRPFRMRPVTRPRSSAPSVGSHTVHLAQQRSLLAESLGQ
D
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgggtactgacaaatttggggccaatgactggctcattgccgatatgcgccagcgctat
ctggcagatcccacttctgttgatgagaggtggcgcgcatacttccaggcactgggagtc
acgcccgatccgtcaacgccggtggcaagcccggccccggtgaccccggcgccaacgcag
gcccccaccccgcaggcccccaccccgcaagcaccgacctcgagcgcaccggggcccaat
gaacctgcccaaccaccgtccagccgcgttcaggcccccgtccccaccctcgagccccgc
gagatccggcggaacgcccccgagcagcccggcatgggtggcggcctgtccgccgacgtg
cccaacccggcagtccgtcccgccaagaaggcggagggccaggccacccgcaccgtgctg
cgcggcattccgaagaccaccgccgtcaacatgaacgaatcgctgtcggtgcccacggcc
acgtccgttcgccaggtgccgatgaagctcgtcatcgacaaccgggcgctggtcaacagc
ttcatggcccgcacccgcggcgggaaggtgagcttcacccacatcatcgccttcgccatg
gtgcaggccatccgtgacgtcccggagatgaaccactcgttcgacatgaccgacggcaag
ccgacgctcgtggagaacccggcgatcaacctggggatcgcgatcgacacgacggcgaag
aacggcacccgggagctgttggtgcccaacatcaaggacgccggcaacttggactttgcg
cagttctggtcggcctacgaggatctcgtggaccgcacccggtcgggcaagctgacgttg
gaggactacgccggcaccacggtgtcgatcaccaacccgggcggcatcggcaccaacatg
tcggtgccgcgcctgatgagcggccaggccatgatcatgggcgtcggaagcatcgactat
ccggccgccttccagggaaccagcacgcagcgcaccaacgacgccgcgatctccaaggtc
tgcaccctgacgtccacctatgaccaccgcatcatccagggggccgtctccggggaattc
ctgcgtcgcatccaccaattgctcctgggcgccgacggcttctacgagcacatctatgag
gcacttcggatcccctatcccccgctgcactgggaccgcgatttcaccgcgaactcgcag
tcggagatctccaagggcgcccgcgtcaccgaactgatccaggcctaccgggccgagggc
cacctgctggccgacctcgatccggtggagtaccggatgcgcacccaccccgacctcgac
ctggccacacatggcctgtccatctgggaccttgaccgtgagttccctgtgggccgcttc
ggtggcgaggaggggcgccacatcgtgctgcgccagatgctcgacatcctgcgcgagtcg
tactgctacacgctggccatcgagtacatgcacatcgacgatcccgaggaacgggcatgg
gtgcaggaacgcttcgagcgtccgcgtaagccccgcccccgggaggaacacctgctgatc
cttgaccggctcagtgaggcggaggtcttcgagaccttcctgcagacgaagtacgtcggg
cagacgcggttcagcatggagggcgcggagtcgtccatcgtcatcctgtcggaactgtgt
gcggccgccgccgatggtggaatggccgaggtgagcatcgggatgccccaccgtgggcgg
ctcaatgtgctgaccaatgtggtgggcaagctctacagccaggtgttccgcgagttcgac
aacaaggtgcccaccgaggaggacatcaccggcgatgtgaaataccacctcggcgcgacc
ggccagttcacggccatgtcgggggagaagatcaaggtctcgttggccgcgaatcccagc
cacctggaggccgtcgatccggtgctggagggcattgcgcgggccaagcgtgatcgtcag
ccggttcccgccgactaccccgtgttgccgatcctcatgcacggcgacgcgtcgttctcg
gcgcagggcatcgtctacgaggtgctgcagatgagccagctgcgcccctaccgggtgggc
ggcaccgtgcacctggtggtcaacaaccagctgggcttcaccacctcacccagcgacggg
cgttcctcgaagtactgcaccgatgtggccaaggccctcggggcaccggtgatccacgtg
aacggcgacgatcccgatgcctgtgcccgggccgccgaactcgccttcgacttccgggcc
cgcttccacaaggacgtcgtcatcgacatggtctgctaccgcctgcgcggtcacaatgag
ggtgacgatcccagcttcacccaaccgcagatgtatgacctggtggcccgcaagggttcg
gtgcgcaaaatctacaccgacgccctgatcgggcgcggcgacatctcggtggaggatgcc
gagcaggcggtcaaccgcttccgggcccgtctcgaggaagtgttctcgatggtccgcaat
cccgagatcccccgcgacgaggtggaccatcaggttgcgtaccgcctggcgccccagtac
ccggccaaggaacgggccgccagcgccccgcccactcccacccgggagcagttcgagcgg
gtggccgacgtctatgagaacctgcccgaggggttcaccccgcatccgaaggtgggtccc
cagctcaagcggcgcgctgattccatccacaatggtccggtcgattgggcgaccgcggag
ctgttggccttcggcacgctgctgcaggatcgtcgccacgtgcgcctcgtcggacaggac
acccgtcggggaaccttcagccagcgcttcggtgccgtggtcgatcgggtgaccaacgag
gcctgggtgccgttgaagcacctgtcggacgatcaggcccccttcgacatctatgactcg
aacctcaccgaatatgccgggatgggctttgagtacgggtactcgacggccgctccggac
gccctggtgctgtgggaggcccagtacggcgacttcgccaatggcgcccagaccattgcc
gacgagttcatctcctcgggcttcgccaagtggcagcaacgctccggcgtcgtcctgctg
cttccgcacggctatgagggtgcgggacccgatcattcgtcgtgccgcatcgaacgctgg
ttgcaaaccgccgacgaggggaacatcgccgtgacgatgcccagcacggcggcaagctac
ttccacctgctgcgccagcacgcctatgtgaactggcaccgtccgctggtggtggccaca
ccgaagtcgatgttgcgcaacaaggcggcggccagcccactgagtgacctgctggacgag
ccctggcggcccgcgctggccgatcccaccatcaccgatcccggagccgtgcggcgcgtc
ctgctgtgcgccggcaagatccgctgggacctggtggccgagcgccgcaagctcggtctg
gacgggcagatcgccatcgtctccctggagcggttgttcccgctgccgaccgccgagctc
gccgagatcctccgggcgttcccgcaggtcaacgacttccgctacgtgcaggaggagccc
gagaaccagggggcctgggaattcatggaccgcttcctgacccccgcgctctcggaggcg
ctgaacaggcccttccggatgcgtccggtcacccggccccgttcgtcggcgccctcggtc
ggctcccacaccgtgcacctggcgcagcagcgctcgttgctggcggaatcgctcggccag
gactga

DBGET integrated database retrieval system