KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_15690Help
Entry
PFREUD_15690      CDS       T01252                                 

Definition
(GenBank) Hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Brite
KEGG Orthology (KO) [BR:pfr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfr01001]
    PFREUD_15690
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PFREUD_15690
Protein kinases [BR:pfr01001]
 Serine/threonine kinases: Other
  Bacterial family
   PFREUD_15690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Pkinase_fungal RIO1 Kdo ABC1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: CBL57067
UniProt: D7GEV6
LinkDB All DBs
Position
1721012..1723255
Genome map
AA seq 747 aa AA seqDB search
MVGDVLAGRYEIVRKLARGGMATVYRARDRRLGRVVAVKVMHEGLGDDADFARKFDREAR
AVARLSDPHVVGVFDQGRDHGRPYIVMEFVEGCTLRNLITREAPFSPARALELIEPVVAA
LAAAHESGLVHRDVKPENVLIGPHGQVKVADFGLARAVTAQTVTAAHGLVIGTVSYLPPE
LVTNGHADARSDIYSTGVVLYELLTGEKPYAGDTPIQVAYAHVNKAVPPPSVTLRRTNHA
PVPDYIDALTVACTRREPDQRPRDGIDLLARLRRARMALAAGVGNDPSLSAIMNPAAFRS
SQVWSGSPTARVDVVHTEPVATRQAALPAQHMAGQQLAGAATGPAATVPAPRLTATMGAS
TTSSVTNSGGIDVLAARQASPSAPPTPRTARSTADPVRPMTAGWRAMSAGSGPRTPVSPV
DFRARLAADPDAQLPRSGRTPRFPELVNDPVHRRRRGIVATVLVILIALGVGCLSWWLAS
GRYVSAPAVIGMNRTVAQGAAQKVGVTISFSEDYDDAVPAGDVVRTTPEAGSRMVRKDEL
HAVISQGPQSYPMPTVVGLDKDAATRALADAHLRVGTIRQDYDADHAEGIVSGASASPGS
QVRHDATVDLTVSKGPAPVKVPGLSGKTREDATAALDALGLKADVSTQHSDAVASGSVIS
QDPADGELRPGDTVKVVVSDGGAPTDVPDVRVRSTADAHKVLEAAGFHVDEVMVDPDARI
RLGRVQRTDPDPGSKLPKGATVKIFII
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
ttggtgggtgacgtgctagccggccgctacgagatcgtgaggaaactcgcgcgtggcggc
atggctaccgtttaccgtgcccgggatcgccgactgggtcgcgtcgttgcagtcaaggtg
atgcatgagggcctcggcgatgacgccgactttgcccgcaagttcgatcgtgaggcccgc
gccgtcgcacggctgtcagatccccatgtggtgggtgtcttcgaccagggacgtgatcac
ggccgcccctatatcgtcatggaattcgtcgagggttgcacgctgcgcaatctgatcacc
cgcgaggcgcccttcagcccggcccgggccctggaactcattgagcccgtcgtggcggct
ctggcggccgcccacgaatccgggctggtgcaccgtgacgtgaagcccgagaacgtgctg
atcggcccgcacgggcaggtgaaggtggccgatttcggcctcgcccgggcggtcacggcc
caaaccgtcaccgcggcacacggactggtgatcggcaccgtcagctatctgccccccgag
ctggtcaccaacggccatgccgacgcgcgctccgacatctattccaccggcgtggtgctc
tacgagctgctcaccggggagaagccctatgcgggtgacacgcccatccaggtggcctat
gcacacgtgaacaaggcggtgcccccgccctcggtcaccctgcggcgcacgaaccatgcc
ccggtgcccgactacatcgacgcgctgaccgtggcctgcacccgccgcgagcccgaccaa
cggccccgcgatggcatcgacctgctggcccggctgcggcgcgcccgcatggcgcttgcg
gccggcgtgggcaatgacccctcgctgtcggccatcatgaatcctgccgcgttccgttcg
tcacaggtctggagtggttcacccaccgcccgggttgatgtcgtgcacaccgaaccggtg
gcgacccgccaggccgccctgccggcccagcacatggcgggccagcagctggccggcgcc
gcgacgggccctgccgcaacggtcccggccccgcgcctgacggccacgatgggggcctcc
accacgagctccgtcaccaattcgggtggcatcgacgtgctggcggcccggcaggcgtcg
cccagtgccccgcccacaccccgcacggcacgctccacggccgacccggtgcgtcccatg
acagccggctggcgtgccatgtcggcaggctccgggccacgcacgccggtgagtccggtc
gatttccgcgcccgcctggcggccgatccggatgcccagctgccgcgcagtggtcgcact
ccgcgcttccctgaactggtcaacgacccggtgcaccgtcgtcggcgcggaatcgtggcc
accgtgctggtgatcctcatcgccctgggcgtcgggtgcctgtcgtggtggctggccagc
ggacgctatgtcagcgcaccggcagtcatcggcatgaaccgcaccgtggcccagggcgct
gcccagaaggtcggcgtgacgatcagcttctccgaggactacgacgacgcggtgccggcc
ggcgacgtggtgcgcacgacccccgaggccggttcacgcatggtgcgcaaggacgaactg
cacgcggtgatctcgcaggggccgcagagctatcccatgcccaccgtggtggggctggac
aaggatgcggccaccagggccctggccgatgcccatctgagggtcggcacgatccggcag
gactatgacgccgaccacgccgagggaatcgtcagcggagccagcgcctcaccgggatcc
caggtgcgccacgacgcgacggtcgacctcacggtctccaagggtccggctccggtgaag
gtgccggggctgagcggcaagacccgcgaggacgccactgccgcgttggacgccctgggg
ttgaaggccgacgtcagcacgcagcattctgatgcggtggcctcgggttcggtgatctcg
caggatcccgccgacggtgagctcaggcccggcgacaccgtcaaggtcgtcgtctccgat
gggggcgcccccacggatgtgcccgatgtgcgtgtccgctcaaccgccgacgcccacaag
gtgctggaggccgcgggcttccacgtcgacgaggtgatggtcgatcccgacgcccgcatt
cgcctggggcgggtgcaacgcaccgaccccgatccgggttccaagctgcccaagggcgcc
acggtgaagatcttcatcatctga

DBGET integrated database retrieval system