KEGG   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1: PFREUD_16010Help
Entry
PFREUD_16010      CDS       T01252                                 

Gene name
glnE
Definition
(GenBank) Glutamate-ammonia-ligase adenylyltransferase ([Glutamate--ammonia-ligase] adenylyltransferase) (Glutamine-synthetase adenylyltransferase) (ATase)
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
pfr  Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
Brite
KEGG Orthology (KO) [BR:pfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFREUD_16010 (glnE)
Enzymes [BR:pfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     PFREUD_16010 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     PFREUD_16010 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294_C
Motif
Other DBs
NCBI-ProteinID: CBL57099
UniProt: D7GEY8
LinkDB All DBs
Position
complement(1752581..1755547)
Genome map
AA seq 988 aa AA seqDB search
MNGRTRTPAGELARKGFIDASRAAELFNGLPECTDELVDALAAAADPDQALAGLVDLQAA
DLVGTLQALAEEPWRRRLIAVLGGSQALGQHLIAHPGDLTALQPEPARWSAEQIRADLLA
EVGLAERADDGLAELAMAVADDPGAADRLRLANKRHLLRIAGRDLSSTQPTAIVDQIAAE
LADLADAIMVCALAIARAQTPHAERARLGIVALGKCGAQELNYLSDIDVLFVGEPATDEV
GQTEAISIANRIAGATARICSAHSAAGTIWQVDAALRPEGNAGPLVRSLEGHRAYYQRWA
KNWEFQAMLKARPMAGDPELTRGFLDITTPLVWQVGGRENFMSDVQAMRRRVVSLIPAKD
AQSEIKLGAGGLRDVEFSVQALQLVHGRVDERLRHRGTLVSLQALAEHGYVGRDDSAALD
ASYRFERCIEHRIQVAKLRRSHLMPPDEADRRRIARSMGMSEAADLWTSWRRTARDVESR
QNKIFYSPLLLTVSKLSDDQIRLSPDAAKDRLKALGFSDPGSALRHIEALTTGSSRAVEI
RRQLMPAMIGWLATGPNPDLGLISFRRLSETMGTTPWYLRALRDGGQMAELLATILSSSR
YDIAMIERDPAAVQLLAEPDELVPRDRTSLDGSMDAVVRRHDGEKEAIDAVRALRRRELL
RLALGDVLGRIDLDALGRGLSDLAGATVGAALAVAVRGEPAGVPPIGVVAMGRWGGAEMS
YASDADAMYVVPDDATPAQIAAAIRVVAKAASLLRLPGADPSLELDADLRPEGRDGAMVR
TLGGYLSYYDRWSQTWEHQALIRAAYGAGDEDLVAQFLAGIDHLRWPPNGLDADEEMAIR
RLKGRMETERIERGTDRRRNLKLGPGGLSDVEWTVQLMQLRHAGTVESLRTPSTMMALDA
CESEGLMTTDDAAVLRDAWQLASQLRNHTMLVRGRTSDQLPPDPRDLSAVAVQLGRNKGE
ASLLIDEYERTTRLASKVVDRLFWGHAE
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacgcacgaggacgccggccggcgagctggcccgcaagggattcatcgacgcc
agccgcgccgccgagctgttcaatggactgcccgaatgcaccgatgaactggtggatgcg
ctggccgcagccgccgaccccgatcaggccctggccggcctggtcgacctgcaggcagcc
gacctggtgggcaccctgcaggccctcgccgaggaaccctggcgccgtcggctgatcgcc
gtgctgggtgggagccaggccctgggccagcacctcatcgcccaccccggagacctgacg
gccctgcaaccggagcccgcacggtggagcgccgaacagatccgagccgacctgctggcc
gaggtcggactggccgagcgggcagatgacggcctcgctgagctcgccatggcggtggcc
gatgatccgggtgccgccgatcggctgcgcctggccaacaagcggcacctgctgcgcatc
gccggacgcgacctgtcctccacccagcccaccgcgatcgtcgaccagatcgccgccgag
ctggcggaccttgccgacgccatcatggtctgtgccctggccatcgcccgcgcacagacc
ccgcacgccgaacgggccaggctcgggatcgtcgccctgggcaagtgcggcgcccaggag
ctgaactacctgtccgacatcgacgtgttgttcgtcggggaaccggcaaccgacgaggtg
ggccagaccgaggccatctcgatcgcgaaccggatcgccggggccacggcgcggatctgc
tcggcacattctgccgccggcaccatctggcaggtcgatgccgcgctgcgtccggagggc
aacgccgggccgctggtgcgcagcctggagggccaccgggcctattaccagcgctgggcg
aagaactgggagttccaggccatgctgaaggcgcgtccgatggccggcgaccccgagctc
acccggggcttcctggacatcaccacgccgctggtgtggcaggtcggtggacgggagaac
ttcatgagcgatgtgcaggccatgcgccgccgcgtggtgagcctcatccccgccaaggac
gcccagagcgagatcaagctgggcgccggcgggctgcgtgacgtggaattcagcgtgcag
gccctgcagctcgtgcacggacgcgtcgacgagcgcctgcgccaccgcggcaccctcgtg
tcattgcaggccctcgccgagcacggctacgtcggacgggacgactccgccgccctggac
gcctcctaccgtttcgagcgctgcatcgagcaccgcatccaggtggccaagctgcgtcga
agccacctcatgccgcccgacgaggccgaccggcgccgcatcgcgcgcagcatggggatg
tcggaggccgcggacctgtggacgagctggcggcgcaccgcccgcgacgtcgagagccgg
cagaacaagatcttctactcgcccctactgctcaccgtcagcaagctgtcggacgaccag
atccggctgtcgcccgacgcggcgaaggaccgcctcaaggcgctgggtttctctgatccg
ggctcggccttgcgccacatcgaggcgctcaccaccggttccagccgggcggtggagatc
cgtcgccagctgatgccggccatgatcggctggctggccaccggcccgaatccggacctc
ggcctgatcagcttccgtcggctgtccgagacgatgggcaccaccccctggtacctcagg
gcgctgcgcgatgggggacagatggccgagctgctggccacgatcctgtcgtccagccgc
tacgacatcgcgatgatcgaacgtgacccggccgccgtccagctgctggccgagcccgac
gagctcgtgccgcgcgatcgcacctccctggatggctcgatggacgcggtggtgcgtcgc
cacgatggcgagaaggaggccatcgacgcggtgcgtgccctgcgccggcgcgaactgctc
aggttggcgctgggcgatgtgctgggccgcatcgacctcgacgccctcggccgggggctc
agcgacctggccggtgccaccgtgggcgccgccctggccgtggcggtccgtggcgaaccc
gccggggtgccgcccatcggggtggtggcgatgggacgctggggtggcgccgagatgagc
tacgcctccgatgccgacgccatgtacgtggtgcccgacgacgccacgccggcgcagatc
gcggccgccatcagggtggtcgccaaggcagcgtcgctgctgcgcctgcccggtgccgac
ccctccctcgagctggatgccgacctgcgccccgagggccgtgacggggccatggtgcgc
accctgggcggctacctcagctactacgaccgatggtcacagacctgggagcaccaggca
ctgatccgcgccgcctacggcgccggggacgaggacctcgtggcgcaattccttgccggc
atcgaccacctacgctggccgcccaacggcttggacgccgatgaggaaatggcgatccgc
cgcctcaaggggcgcatggagaccgagcgcatcgagcggggcaccgatcgtcggcgcaac
ctcaagctgggccccggtggcctgtccgacgtcgaatggacggtgcaactgatgcaactg
cgtcacgccggcaccgtcgaatccctgcgcacgccctcgacgatgatggccctggacgcc
tgcgagagcgagggactcatgaccaccgacgatgccgccgtcctgcgtgacgcctggcag
ctcgccagccaattgcgaaaccacacgatgctggtgcgcggacgcaccagcgaccagctg
ccacccgacccgcgcgacctgtcagccgtcgcggtgcagttggggcgcaacaagggggag
gcgtccctgctgatcgacgaatacgagcgcaccacccggctcgcgtccaaggtcgtggac
cgcttgttctgggggcatgcggagtga

DBGET integrated database retrieval system